Get 20M+ Full-Text Papers For Less Than $1.50/day. Start a 7-Day Trial for You or Your Team.

Learn More →

Novel phytochrome sequences in Arabidopsis thaliana: structure, evolution, and differential expression of a plant regulatory photoreceptor family.

Novel phytochrome sequences in Arabidopsis thaliana: structure, evolution, and differential... Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochrome sequences in Arabidopsis thaliana: structure, evolution, and differential expression of a plant regulatory photoreceptor family Robert A. Sharrock^ and Peter H. Quail Plant Gene Expression Center, Albany, California 94710 USA Phytochrome is a plant regulatory photoreceptor that mediates red light effects on a wide variety of physiological and molecular responses. DNA blot analysis indicates that the Arabidopsis thaliana genome contains four to five phytochrome-related gene sequences. We have isolated and sequenced cDNA clones corresponding to three of these genes and have deduced the amino acid sequence of the full-length polypeptide encoded in each case. One of these proteins ipbyA) shows 65-80% amino acid sequence identity with the major, etiolated-tissue phytochrome apoproteins described previously in other plant species. The other two polypeptides {pbyB and pbyC) are unique in that they have low sequence identity (-50%) with each other, with pbyA, and with all previously described phytochromes. The pbyA, pbyB, and pbyC proteins are of similar molecular mass, have related hydropathic profiles, and contain a conserved chromophore attachment region. However, the sequence comparison data indicate that the three pby genes diverged early in plant evolution, well before the divergence of the two major groups of angiosperms, the monocots and dicots. The steady-state level of the pbyA transcript is high in dark-grown A. tbaliana seedlings and is down-regulated by light. In contrast, the pbyB and pbyC transcripts are present at lower levels and are not strongly light-regulated. These findings indicate that the red/far red light-responsive phytochrome photoreceptor system in A. tbaliana, and perhaps in all higher plants, consists of a family of chromoproteins that are heterogeneous in structure and regulation. [Key Words: Arabidopsis thaliana-, phytochrome; photomorphogenesis; plant gene family; angiosperm evolution; gene expression] Received June 29, 1989; revised version accepted September 4, 1989. Light is an important environmental factor controlling ceptor is one of the primary components of the regula­ plant growth and development. Not only does light pro­ tory system for higher plant photomorphogenesis. vide energy for photosynthesis, but plant growth pat­ The molecular properties of phytochrome have been terns and a large number of plant developmental events, determined most extensively for the abundant chromo- such as formation of leaf primordia, plastid develop­ protein species purified from dark-grown (etiolated) oat ment, and induction of flowering, are also responsive to tissue (Vierstra and Quail 1983). This species is a dimer light cues (Salisbury and Ross 1985). Physiological ex­ of 124-kD subunits (Jones and Quail 1986), each of periments suggest that two major plant regulatory pho­ which contains a covalently attached linear tetrapyrrole toreceptor systems are active in perception of light cues: chromophore (Rudiger and Scheer 1983). The complete one system sensing shorter wavelength blue and UV-A amino acid sequences of the abundant, etiolated-tissue light, and the second sensing predominantly longer phytochrome from oat (Hershey et al. 1985), zucchini wavelength red/far red light (Shropshire and Mohr 1983). (Sharrock et al. 1986), pea (Sato 1988), rice (Kay et al. Up to this time, only the red/far red-responsive photore­ 1989a), and com (Christensen and Quail 1989), have ceptor phytochrome has been isolated (Vierstra and been derived from the corresponding nucleic acid se­ Quail 1986). The quality and quantity of incident red quences. The molecular mechanism of action of phy­ and far red light influence a broad range of responses tochrome is not known. No enzymatic or specific pro­ throughout the plant life cycle and in a wide variety of tein or nucleic acid-binding activity has been assigned to organs and tissues, indicating that the phytochrome re- the chromoprotein. Nonetheless, it is clear that the unique photochromic properties of phytochrome are re­ sponsible for its regulatory function. Phytochrome, both •Present address: Depaitment of Biology, Montana State University, Bozeman, Montana 59717 USA. in plants and as a purified chromoprotein, exists in ei- GENES & DEVELOPMENT 3:1745-1757 © 1989 by Cold Spring Harbor Laboratory Press ISSN 0890-9369/89 $1.00 1745 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shairock and Quail ther of two spectrally distinct conformations: P^ (red (Meyerowitz 1987). In particular, we anticipated that the light-absorbing, X^^ = 666 nm) or Pf^ (far red light-ab­ small genome size of A. thaliana might assist in estab­ sorbing, V „ = 730 nm) (Vierstra and Quail 1983). lishing the minimum number of phytochrome genes These conformations are photointerconvertiblc; irradia­ present in higher plants. Here, we demonstrate that phy­ tion with red light converts Pr to Pf^ and, conversely, ir­ tochrome in A. thaliana is encoded by a small gene radiation with far red light converts Pf^ back to P^. For family of at least three, but more likely four or five, most phytochrome responses, conversion to Pfr induces members. We present the primary sequence of three of the response, and conversion back to P^ cancels the in­ these gene products and their phylogenetic relationship duction (Shropshire and Mohr 1983). In this way, phy­ to each other and to previously described phytochromes. tochrome functions as a reversible regulatory switch for In addition, we present preliminary studies on the ap­ plant photomorphogenic events. parent differential regulation of these genes. In addition to simply being induced by red light, many phytochrome responses show sensitivity to the balance of red and far red light (Smith 1986) and to the intensity Results and duration of illumination (Mancinelli and Rubino Isolation and sequence of phytochrome cDNA clones 1978; Mandoli and Briggs 1981). The complex action from A. thaliana spectra, variability of response and escape times, and differential level of far red reversibility of phytochrome A probe generated by nick-translation of the zucchini responses have frequently been interpreted within the phytochrome cDNA clone pFMDl (Lissemore et al. context of the known molecular properties of the appar­ 1987) was used initially to screen an Arabidopsis ge­ ently homogeneous phytochrome extracted from etio­ nomic library, and a single A. thaliana genomic phy­ lated plant tissue (Kronenberg and Kendrick 1986). tochrome clone was isolated (R. Sharrock, C. Gatz, and Nonetheless, for some time, the possibility has been rec­ P. Quail, unpubl.). Comparison of phytochrome se­ ognized that less abundant forms of phytochrome might quences from distantly related plant species has shown exist and that these might play important or even pre­ previously that the highest conservation of amino acid dominant roles in photoregulation. Indeed, some physio­ and nucleic acid sequence occurs in the amino-terminal logical observations, such as the Zea and Pisum 'para­ half of the receptor, around the chromophore attach­ doxes' (Hillman 1967) and in vivo spectroscopic data ment site (Sharrock et al. 1986). Therefore, a 0.9-kb (Jabben and Holmes 1983), are very difficult to explain single-stranded DNA (ssDNA) probe was prepared from on the basis of one pool of homogeneous phytochrome. the A. thaliana genomic clone covering this region of Tokuhisa and Quail (1983) presented the first direct evi­ the phytochrome-coding sequence (0.9-kb probe; Fig. 1). dence that extracts of fully green oat tissue contain two Blots of total A. thaliana DNA digested with restriction pools of phytochrome: a greatly reduced level of the enzymes show multiple bands of hybridization to this etiolated-tissue form and a second, immunochemically probe (Fig. lA), indicating that the Arabidopsis genome distinct form. Further experiments confirmed these ob­ contains multiple copies of phytochrome-related coding servations (Shimazaki and Pratt 1985; Tokuhisa et al. sequence. 1985) and extended them to a dicot species, pea (Abe et The 0.9-kb probe was used to screen a XgtlO size-frac­ al. 1985). The green-tissue phytochrome from oats is of tionated cDNA library made from poly(A)+ RNA iso­ lower molecular mass, has different spectral properties, lated from 3-week-old green A. thaliana leaves (Craw­ and is more stable in vivo in the presence of light when ford et al. 1988). Several clones were isolated that hy­ compared to the etiolated-tissue form (Tokuhisa et al. bridized to the probe under high-stringency wash 1985). conditions, and the insert from one of these clones, \A2-3, was sequenced. The X.A2-3 insert (Fig. 2A) con­ The biochemical and physiological evidence for a tains the complete amino acid-coding sequence for a second pool of phytochrome led us to screen for plant 124-kD polypeptide (phyA; Fig. 2B), 5'- and 3'-noncoding genomic sequences and cDNA clones that cross-hy­ sequence, and a poly(A) tail. Clones showing less stable bridize under low stringency conditions with nucleic hybridization to the 0.9-kb probe were separated into acid probes derived from the coding sequence of the two classes on the basis of restriction enzyme analysis, abundant, etiolated-tissue phytochrome. This approach and the inserts from representatives of these classes, has been instrumental in the identification of novel XA7-5 and \A1-I, were sequenced (Fig. 2A). The XA7-5 components of receptor and signal transduction systems insert contains the complete amino acid-coding se­ in animals. It has been used successfully to isolate quence for a 129-kD polypeptide (phyB; Fig. 2B), and members of several gene families such as steroid and XAl-I contains the complete coding sequence for a 124- thyroid hormone receptors (Thompson et al. 1987; Gi- guere et al. 1988), protein kinases (Ohno et al. 1988; kD polypeptide (phyC; Fig. 2B). Both of these inserts Schaeffer et al. 1989), and potassium charmels (Butler et contain 5'- and 3'-noncoding sequence and poly(A) tails. al. 1989). We chose to screen for phytochrome-related Restriction enzyme analysis and hybridization of the sequences in Arabidopsis thaliana, a small cruciferous three A. thaliana phytochrome cDNA clones to ge­ plant that exhibits typical photoresponsive character­ nomic DNA blots under high stringency conditions show that the central coding regions of the phyA, phyB, istics and has many features that distinguish it as a and phyC genes correspond to the bands indicated in the model plant system for molecular genetic studies 1746 GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochromes in Arabidopsis quence of the amino-terminal coding region of the phyB Coding regton probe B) Transcript-specific probes cDNA was confirmed by sequencing the same region of 0.9 kb probe AB C an A. thaliana genomic phyB clone (R. Sharrock and P. E H P E H EH EH Quail, unpubl.). kb — 23 Comparison of A. thaliana phytochromes A, B, and C 9.4 It has been reported previously that there are multiple phytochrome genes in oat (Hershey et al. 1985). How­ phyA ever, oat is hexaploid and the genes described encode al­ 4.4 most identical polypeptides (>98% identical). Genomic phyB Southern blot analyses of pea and rice DNA have been interpreted to indicate the presence of only single phy­ tochrome genes (Sato 1988; Kay et al. 1989b) and cDNA 2.3 cloning from zucchini (Lissemore et al. 1987), pea (Sato 2.0 1988), and rice (Kay et al. 1989b| indicated the presence of only a single type of phytochrome transcript in etio­ lated tissue of these plant species. Our results in Arabi­ phyC — dopsis (Figs. 1 and 2) contrast markedly with these pre­ vious reports. To compare the three A. thahana phy­ tochromes, the deduced amino acid sequences of phyA, phyB, and phyC have been aligned in Figure 2B in such a 0.6 way as to minimize the number of gaps introduced. A consensus sequence of residues conserved in all three TAG polypeptides is shown below the alignments. In all pair- X A2-3 iphyA) ^3 1 :^(AAA . .) wise combinations, the phyA, phyB, and phyC polypep­ 0.9 kb probe ATG TAG tides are approximately equally related to one another, X A7-5 [phyB) H I I lk\V\N (AAA 49-52 % identical (Table 1). This level of sequence con­ ATG TGA servation indicates significant structural heterogeneity x^^-^ {phyqE^z :^(AAA... ) and distant evolutionary origins (see Phylogeny of phy­ tochrome genes, below). To better visualize the structural relatedness of the Figure 1. Southern blot analysis of total A. thaliana DNA hy­ phyA, phyB, and phyC polypeptides, the distribution of bridized with a phytochrome-coding region probe (0.9-kb probe) amino acid sequence conservation along each pair of the or with probes specific for the phyA, phyB, and phyC tran­ aligned phytochrome sequences is presented in Figure 3 scripts. Diagrams of the cDNA inserts from the \gtlO phy as a linear plot of percent identity within a 9-amino-acid clones are shown below the blots, and the internal £coRI sites moving window. Short conserved regions are observed and the positions of the probes are indicated. Restriction en­ over almost the entire lengths of phyA, phyB, and phyC. zymes are (E) £coRI; (H) HindUl; (P) Pstl. Similar regions of the three polypeptides are either highly conserved or prone to substitutions, and no large structural domains are conserved in two of the proteins JEcoRI digest on the Southern blot in Figure lA (data not and lost in the third. These data indicate that the overall shown). No cDNA clones corresponding to the two structure of these proteins is conserved. Consistent with highest molecular weight bands in this digest were re­ this interpretation, hydropathy profiles for phyA, phyB, covered in this screen. and phyC are very similar over their entire lengths (Fig. In all three cDNA clones, the initiator methionine 4). Notable deviation from this conserved phytochrome codon for the large phytochrome open reading frame structure occurs at the ends of the phyB polypeptide in (ORF) is not the first AUG present at the 5' end of the the form of amino- and carboxy-terminal extensions. mRNA. The upstream open reading frames (URFs) in The 35-residue phyB amino-terminal extension is un­ each mRNA encode short peptides, 3-12 residues in usual in its high glycine content (37%) and the presence length, before an in-frame translation termination codon of numerous amino acid doublet and triplet repeats (Fig. is reached (Fig. 2A). The large ORF oiphyB contains two 2B), the ftmctional significance of which is not known. methionines in its first 54 amino acids. Initiation of translation at the first methionine gives rise to the 129- kD protein shown in Figure 2B. Initiation at the second Phylogeny of phytochrome genes methionine would produce a 124-kD protein similar to the other phytochrome apoproteins; however, there is The amino acid sequences of the three A. thaliana phy­ currently no reason to invoke preferential initiation at tochromes and the published sequences of phy­ this site. To eliminate the possibility that the first in- tochromes from oat (Hershey et al. 1985), zucchini frame ATG of the phyB sequence was introduced (Sharrock et al. 1986), pea (Sato 1988), rice (Kay et al. through a cDNA cloning artifact, the nucleotide se­ 1989a), and com (Christensen and Quail 1989), have GENES & DEVELOPMENT 1747 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shanock and Quail r^ 1 URF-B 100 A CGTCGTCGTCTGTGTTAGGGAGCACAAATAATAGAGAGGCGTAGCACAAGAGAGAAGGTGGTGATCGAGGCCAAGAT B GTCTCCGATAACTAGTGGATGATGATTCACCCTAAATCCTTCCTTGTCTCAAGGTAATTCTGAGAAATTTCTCAAATTCAAAATCAAA C CAACTTACAAGTTCCTCTCTCAGCTTCTCTCCCACCACTAAGGAGGAACGTTCCAAAGATCCCTTTCTCAGAGAATTCCCAGAAAAATCTTCAACAATTG *B URF-C URF-A 200 A TTAGAATTTAACTATAACAAAAAGCCTCTGACGAGTGTGACTAGTCACAAGATCTGATCATGGCTTrTTGAAACTTCTTCTTCTTCTTTCTTCTCTTTAA B CGGC^rgSTTTCCGGAGTCGGGGGTAGTGGCGGTGGCCGTGGCGGTGGCCGTGGCGGAGAAGAAGAACCGTCGTCAAGTCACACTCCTAATAACCGAAGA C AAACCCTAATGGAGAATCATTCGGATCCTTGAATCCTTTGGTTTGTrTrTCACCTrrATTTCTGAAATTTCATTGCTTTGTGATTCTTCTGCAGATTCGT *A *C 300 A AGGAAAAA^jATGfTCAGGCTCTAGGCCGACTCAGTCCTCTGAGGGCTCAAGGCGATCAAGGCACAGCGCTAGGATCATTGCGCAGACCACTGTAGATGCGA B GGAGGAGAACAAGCTCAATCGTCGGGAACGAAATCTCTCAGACCAAGAAGCAACACTGAATCAATGAGCAAAGCAATTCAACAGTACACCGTCGACGCAA C TTTGAAGAGAAGAAAGA;j^fgrCATCGAACACTTCACGAAGCTGTTCTACTAGATCTAGACAAAACTCTCGAGTTTCTTCACAAGTTCTCGTCGACGCAA A AACTCCATGCTGATTTTGAG GAGTCAGGCAGCTCCTTTGATTACTCAACCTCAGTGCGTGTCACTGGCCCGGTTGTGGAGAATCAGCCACC B GACTCCACGCCGTTTTCGAACAATCCGGCGAATCAGGGAAATCATTCGACTACTCACAATCACTCAAAACGACGACG TACGGTTCCTC C AGCTACACGGAAACTTCGAA GAATCTGAGCGTTTATTTGACTATTCAGCTTCAATAAACTTGAACATGCCAAGTTCTTCCTGTGAGATTCC A AAGGTCTGACAAAGTTACCACGACTTATCTTCATCATATACAGAAGGGAAAGCTGATTCAGCCCTTCGGTTGTTTACTTGCCTTGGATGAGAAGACCTTC B TGTACCTGAGCAACAGATCACAGCTTATCTCTCTCGAATCCAGCGAGGTGGTTACATTCAGCCTTTCGGATGTATGATCGCCGTCGATGAATCCAGTTTC C TTCTTCAGCT GTCTCAACGTACTTACAGAAGATTCAGAGAGGGATGTTGATTCAACCCTTTGGTTGTTTAATCGTTGTTGATGAGAAAAACCTT A AAAGTTATTGCATACAGCGAGAATGCATCTGAGCTGTTGACAATGGCCAGTCATGCAGTTCCTAGTGTTGGCGAACACCCTGTTCTAGGCATTGGGACAG B CGGATCATCGGTTACAGTGAAAACGCCAGAGAAATGTTAGGGATTATGCCTCAATCTGTTCCTACTCTTGAGAAACCTGAGATTCTAGCTATGGGAACTG C AAAGTCATTGCCTTTAGTGAAAACACTCAAGAGATGTTGGGTTTGATTCCACATACAGTACCAAGTATGGAGCAGCGTGAAGCTTTGACTATAGGAACTG A ATATAAGGAGTCTTTTCACTGCTCCTAGTGCGTCTGCATTGCAGAAAGCCCTTGGATTTGGAGATGTCTCTCTTTTGAATCCCATTCTTGTGCACTGCAG B ATGTGAGATCTTTGTTCACTTCTTCGAGCTCGATTCTACTCGAGCGTGCTTTCGTTGCTCGAGAGATTACCTTGTTAAATCCGGTTTGGATCCATTCCAA C ATGTGAAATCATTGTTTCTGTCTCCAGGTTGTTCTGCTTTGGAGAAAGCTGTTGACTTTGGTGAGATTAGTATTTTGAATCCTATCACGCTTCATTGTAG A GACTTCTGCAAAGCCCTTTTATGCGATTATCCACAGGGTTACAGGGAGCATCATCATCGACTTTGAACCCGTGAAGCCTTATGAAGTCCCCATGACAGCT B GAATACTGGTAAACCGTTTTACGCCATTCTTCATAGGATTGATGTTGGTGTTGTTATTGATTTAGAGCCAGCTAGAACTGAAGATCCTGCGCTTTCTATT C GTCTTCAAGTAAGCCTTTTTATGCGATTCTGCATCGGATTGAGGAAGGTCTTGTTATAGATTTGGAGCCTGTGAGTCCTGATGAGGTGCCTGTGACTGCT A GCTGGTGCCTTACAATCATACAAGCTCGCTGCCAAAGCAATCACTAGGCTGCAATCTTTACCCAGCGGGAGTATGGAAAGGCTTTGTGATACAATGGTTC B GCTGGTGCTGTTCAATCGCAGAAACTCGCGGTTCGTGCGATTTCTCAGTTACAGGCTCTTCCTGGTGGAGATATTAAGCTTTTGTGTGACACTGTCGTGG C GCCGGGGCTTTAAGATCGTATAAGCTTGCGGCGAAATCGATTTCGAGGTTGCAGGCATTGCCTAGTGGGAATATGTTGTTGTTGTGTGATGCTTTGGTTA A AAGAGGTTTTTGAACTCACGGGGTATGACAGGGTGATGGCTTATAAGTTTCATGAAGATGATCACGGTGAGGTTGTCTCCGAGGTTACAAAACCTGGGCT B AAAGTGTGAGGGACTTGACTGGTTATGATCGTGTTATGGTTTATAAGTTTCATGAAGATGAGCATGGAGAAGTTGTAGCTGAGAGTAAACGAGACGATTT C AGGAAGTTAGTGAATTAACTGGTTATGATAGGGTGATGGTGTATAAGTTCCATGAGGATGGGCATGGGGAAGTGATTGCTGAATGCTGCCGGGAAGATAT A GGAGCCTTATCTTGGGCTGCATTATCCTGCCACCGACATCCCTCAAGCAGCCCGTTTTCTGTTTATGAAGAACAAGGTCCGGATGATAGTTGATTGCAAT B AGAGCCTTATATTGGACTGCATTATCCTGCTACTGATATTCCTCAAGCGTCAAGGTTCTTGTTTAAGCAGAACCGTGTCCGAATGATAGTAGATTGCAAT C GGAACCTTATCTTGGGTTGCATTACTCCGCTACTGATATACCGCAAGCTTCGAGATTTCTGTTTATGAGAAACAAGGTTAGGATGATTTGTGATTGTTCA A GCAAAACATGCTAGGGTGCTTCAAGATGAAAAGCTTTCCTTTGACCTTACCTTGTGTGGCTCCACCCTTAGAGCACCGCACAGCTGCCATTTGCAGTACA B GCCACACCTGTTCTTGTGGTCCAGGACGATAGGCTAACTCAGTCTATGTGCTTGGTTGGTTCTACTCTTAGGGCTCCTCATGGTTGTCACTCTCAGTATA C GCGGTTCCGGTTAAAGTCGTTCAAGATAAGAGTCTCTCACAGCCAATAAGTCTTTCTGGATCTACTTTGAGAGCTCCTCATGGTTGTCACGCACAGTATA A TGGCCAACATGGATTCAATTGCATCTCTGGTTATGGCGGTTGTAGTTAACGAGGAAGATGGAGAAGGGGATGCTCCTGATGCTACTACACAGCCTCAAAA B TGGCTAACATGGGATCTATTGCGTCTTTAGCAATGGCGGTTATAATCAATGGAAATGAAGATGATGGGAGCAATGTAGCTAGTGGA AGAAG C TGAGTAATATGGGATCAGTGGCGTCTCTTGTCATGTCTGTAACTATCAATGGTAGTGATAGTGATGAGATGAACAGAGATTTA CAGAC A GAGAAAGAGACTATGGGGTTTAGTGGTTTGTCACAATACGACTCCGAGGTTTGTTCCATTTCCTCTCAGGTATGCCTGTGAGTTTCTAGCTCAAGTGTTT B CTCGATGAGGCTTTGGGGTTTGGTTGTTTGCCATCACACTTCTTCTCGCTGCATACCGTTTCCGCTAAGGTATGCTTGTGAGTTTTTGATGCAGGCTTTC C TGGCAGACACTTATGGGGCTTGGTGGTTTGTCATCACGCAAGTCCTAGATTTGTTCCGTTTCCATTACGATATGCTTGTGAATTCTTGACTCAAGTATTT A GCCATACACGTCAATAAGGAGGTGGAACTCGATAACCAGATGGTGGAGAAGAACATTTTGCGCACGCAGACACTCTTGTGCGATATGCTGATGCGTGATG B GGTTTACAGTTAAACATGGAATTGCAGTTAGCTTTGCAAATGTCAGAGAAACGCGTTTTGAGAACGCAGACACTGTTATGTGATATGCTTCTGCGTGACT C GGCGTGCAGATCAACAAAGAAGCGGAATCAGCTGTTCTGTTGAAAGAGAAGCGTATTTTGCAAACTCAGAGTGTGCTATGTGACATGCTTTTCCGCAATG A CTCCACTGGGTATTGTGTCGCAAAGCCCCAACATAATGGACCTTGTGAAATGTGATGGAGCAGCTCTCTTGTATAAAGACAAGATATGGAAACTGGGAAC B CGCCTGCTGGAATTGTTACACAGAGTCCCAGTATCATGGACTTAGTGAAATGTGACGGTGCAGCATTTCTTTACCACGGGAAGTATTACCCGTTGGGTGT C CACCAATAGGTATAGTCACTCAATCACCAAATATAATGGATCTTGTTAAATGTGATGGAGCAGCATTATATTACAGAGACAACCTCTGGTCTCTAGGAGT A AACTCCAAGTGAGTTCCACCTGCAGGAGATAGCTTCATGGTTGTGTGAATACCACATGGATTCAACGGGTTTGAGCACTGATAGTTTGCATGACGCCGGG B TGCTCCTAGTGAAGTTCAGATAAAAGATGTTGTGGAGTGGTTGCTTGCGAATCATGCGGATTCAACCGGATTAAGCACTGATAGTTTAGGCGATGCGGGG C TACTCCCACAGAGACACAAATTAGAGATCTAATTGACTGGGTTCTCAAAAGTCATGGAGGAAACACTGGCTTTACCACTGAAAGTCTAATGGAGTCTGGC A TTTCCTAGGGCTCTATCTCTCGGGGATTCGGTATGTGGGATGGCAGCTGTGAGGATATCATCGAAAGACATGATTTTCTGGTTCCGTTCTCATACCGCTG B TATCCCGGTGCAGCTGCGTTAGGGGATGCTGTGTGCGGTATGGCAGTTGCATATATCACAAAAAGAGACTTTCTTTTTTGGTTTCGATCTCACACTGCGA C TATCCGGATGCTTCTGTTCTTGGGGAGTCAATATGTGGAATGGCTGCCGTATATATTTCCGAAAAAGATTTCCTTTTCTGGTTCCGGTCTAGCACTGCAA A GTGAAGTGAGATGGGGAGGTGCGAAGCATGATCCAGATGATAGGGATGATGCAAGGAGAATGCACCCAAGGTCATCGTTCAAGGCTTTCCTTGAAGTGGT B AAGAAATCAAATGGGGAGGCGCTAAGCATCATCCGGAGGATAAAGATGATGGGCAACGAATGCATCCTCGTTCGTCCTTTCAGGCTTTTCTTGAAGTTGT C AACA6ATCAAGTGGGGTGGTGCAAGACACGATCCTAATGACAGA...GATGGTAAGAGAATGCATCCTAGATCCTCATTCAAGGCTTTTATGGAAATAGT A CAAGACAAGGAGTTTACCTTGGAAGGACTATGAGATGGATGCCATACACTCCTTGCAACTTATTTTGAGGAATGCTTTCAAGGATAGTGAAACTACT. . . B TAAGAGCCGGAGTCAGCCATGGGAAACTGCGGAAATGGATGCGATTCACTCGCTCCAGCTTATTCTGAGAGACTCTTTTAAAGAATCTGAGGCGGCTATG C CAGGTGGAAAAGTGTGCCCTGGGATGACATGGAAATGGATGCAATTAATTCTCTGCAGCTAATAATAAAAGGCTCATTGCAAGAGGAGCATTCA Figure 2. (See p. 1750 for legend. ] 1748 GENES &, DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochiomes in Arabidopsis A GATGTGAATACAAAGGTCATTTACTCGAAGCTAAATGATCTCAAAATTGATGGTATACAAGAACTAGAAGCTGTGACCAGTGAGATGGTTCGTT B AACTCTAAAGTTGTGGATGGTGTGGTTCAGCCATGTAGGGATATGGCGGGGGAACAGGGGATTGATGAGTTAGGTGCAGTTGCAAGAGAGATGGTTAGGC C AAGACTGTTGTGGATGTCCCACTTGTGGATAATAGGGTTCAGAAGGTAGATGAATTGTGTGTTATCGTGAATGAAATGGTGCGGT A TAATTGAGACTGCTACGGTGCCAATATTGGCGGTTGATTCTGATGGACTGGTTAATGGTTGGAACACGAAAATTGCTGAGCTGACTGGTCTTTCGGTTGA B TCATTGAGACTGCAACTGTTCCTATATTCGCTGTGGATGCCGGAGGCTGCATCAATGGATGGAACGCTAAGATTGCAGAGTTGACAGGTCTCTCAGTTGA C TGATTGATACAGCAGCTGTTCCCATCTTTGCGGTTGATGCCTCTGGTGTTATAAATGGTTGGAATTCTAAAGCGGCTGAGGTAACAGGATTGGCAGTTGA A TGAAGCAATCGGGAAGCATTTCCTCACA. . . CTTGTTGAAGATTCTTCAGTGGAAATCGTTAAAAGGATGCTAGAGAACGCATTAGAAGGAACTGAGGAG B AGAAGCTATGGGGAAGTCTCTGGTTTCTGATTTAATATACAAAGAGAATGAAGCAACTGTCAATAAGCTTCTTTCTCGTGCTTTGAGAGGGGACGAGGAA C ACAAGCAATAGGCAAACCT...GTATCAGATCTCGTTGAGGACGATTCTGTAGAAACCGTGAAGAACATGTTAGCCTTGGCTCTCGAAGGTAGTGAAGAA A CAGAATGTCCAGTTTGAGATCAAGACACATCTGTCCAGGGCTGATGCTGGGCCAATAAGTTTAGTTGTAAATGCATGCGCAAGTAGAGATCTCCATGAAA B AAGAATGTGGAGGTTAAGCTGAAAACTTTCAGCCCCGAACTACAAGGGAAAGCAGTTTTTGTGGTTGTGAATGCTTGTTCCAGCAAGGACTACTTGAACA C CGTGGTGCTGAGATCAGGATCAGAGCATTTGGTCCTAAAAGGAAAAGCAGTCCGGTTGAGTTAGTTGTCAACACTTGTTGTAGCAGAGATATGACGAATA A ACGTGGTTGGGGTGTGTTTTGTAGCCCATGATCTTACTGGCCAGAAGACTGTGATGGACAAGTTTACGCGGATTGAAGGTGATTACAAGGCAATCATCCA B ACATTGTCGGCGTTTGTTTTGTTGGACAAGACGTTACTAGTCAGAAAATCGTAATGGATAAGTTCATCAACATACAAGGAGATTACAAGGCTATTGTACA C ATGTTCTTGGTGTATGCTTCATTGGACAAGATGTTACAGGCCAGAAAACGCTTACTGAAAACTATAGCCGCGTGAAAGGAGATTATGCCCGAATCATGTG A AAATCCAAACCCGCTGATCCCGCCAATATTTGGTACCGATGAGTTTGGATGGTGCACAGAGTGGAATCCAGCAATGTCAAAGTTAACCGGTTTGAAGCGA B TAGCCCAAACCCTCTAATCCCGCCAATTTTTGCTGCTGACGAGAACACGTGCTGCCTGGAATGGAACATGGCGATGGAAAAGCTTACGGGTTGGTCTCGC C GAGCCCTTCCACACTCATTCCACCAATTTTTATAACCAATGAAAATGGGGTATGCTCAGAGTGGAACAACGCAATGCAGAAGCTCTCTGGGATAAAGAGA A GAGGAAGTGATTGACAAAATGCTCTTAGGAGAAGTATTTGGGACGCAGAAGTCATGTTGTCGTCTAAAGAATCAAGAAGCCTTTGTAAACCTTGGGATTG B AGTGAAGTGATTGGGAAAATGATTGTCGGGGAAGTGTTTGGG AGCTGTTGCATGCTAAAGGGTCCTGATGCTTTAACCAAGTTCATGATTG C GAAGAAGTTGTCAATAAAATTCTTCTCGGGGAGGTTTTTACCACAGATGATTATGGTTGCTGCCTTAAAGACCATGACACTTTAACGAAGCTGAGAATAG A TGCTGAACAATGCTGTGACCAGTCAA...GATCCAGATAAAGTATCGTTTGCTTTCTTTACAAGAGGTGGCAAGTATGTGGAGTGTCTGTTGTGTGTGAG B TATTGCATAATGCGATTGGTGGCCAA...GATACGGATAAGTTCCCTTTCCCATTCTTTGACCGCAATGGGAAGTTTGTTCAGGCTCTATTGACTGCAAA C GTTTCAATGCTGTGATTTCTGGCCAAAAGAACATAGAGAAGCTTTTATTTGGCTTTTACCATCGTGATGGTAGCTTCATCGAGGCATTGCTTTCTGCAAA A TAAGAAACTGGACAGGAAAGGTGTAGTGACAGGTGTCTTCTGTTTCCTGCAACTTGCCAGCCATGAGCTGCAGCAAGCGCTCCATGTTCAACGTTTAGCT B CAAGCGGGTTAGCCTCGAGGGAAAGGTTATTGGGGCTTTCTGTTTCTTGCAAATCCCGAGCCCTGAGCTGCAGCAAGCTTTAGCAGTCCAACGGAGGCAG C CAAAAGGACTGATATTGAGGGAAAGGTTACCGGGGTTTTATGCTTTTTGCAAGTACCTAGTCCAGAACTCCAATATGCTCTACAGGTTCAGCAAATATCA A GAGCGAACCGCAGTGAAGAGACTAAAGGCTCTAGCATACATAAAAAGACAGATCAGGAATCCGCTATCTGGGATCATGTTTACAAGGAAAATGATAGAGG B GACACAGAGTGTTTCACGAAGGCAAAAGAGTTGGCTTATATTTGTCAGGTGATAAAGAATCCTTTGAGCGGTATGCGTTTCGCAAACTCATTGTTGGAGG C GAGCATGCAATTGCCTGTGCCCTCAACAAATTGGCATATCTCCGCCATGAAGTGAAGGACCCCGAAAAGGCAATATCCTTCCTTCAAGATTTGCTCCATT A GTACTGAATTAGGACCAGAGCAAAGACGGATTTTGCAAACTAGCGCGTTATGTCAGAAGCAACTAAGCAAGATCCTCGATGATTCGGATCTTGAAAGCAT B CCACAGACTTGAACGAGGACCAGAAGCAGTTACTTGAAACAAGTGTTTCTTGCGAGAAACAGATCTCAAGGATCGTCGGGGACATGGATCTTGAAAGCAT C CATCTGGATTAAGTGAAGACCAAAAGCGGCTCCTGAGGACAAGCGTTTTATGCAGGGAGCAGTTAGCCAAAGTCATAAGCGACTCAGACATAGAGGGAAT A CATTGAAGGATGCTTGGATTTGGAAATGAAAGAATTCACCTTAAATGAAGTGTTGACTGCTTCCACAAGTCAAGTAATGATGAAGAGTAACGGAAAGAGT B TGAAGACGGTTCATTTGTGCTAAAGAGGGAAGAGTTTTTCCTTGGAAGTGTCATAAACGCGATTGTAAGTCAAGCGATGTTCTTATTAAGGGACAGAGGT C CGAAGAAGGCTATGTGGAACTGGATTGCAGCGAATTCGGCCTGCAGGAATCCCTGGAAGCAGTTGTAAAACAAGTGATGGAGCTGAGCATAGAACGTAAA A GTTCGGATAACAAATGAGACCGGAGAAGAAGTAATGTCTGACACTTTGTATGGAGACAGTATTAGGCTTCAACAAGTCTTGGCAGATTTCATGCTGATGG B CTTCAGCTGATCCGTGACATTCCCGAAGAGATCAAATCAATAGAGGTTTTTGGAGACCAGATAAGGATTCAACAGCTCCTGGCTGAGTTTCTGCTGAGTA C GTACAAATCAGCTGCGATTATCCTCAAGAAGTTTCATCAATGAGATTGTATGGAGACAACTTAAGGCTTCAGCAAATCCTTTCAGAGACACTATTAAGCA A CTGTAAACTTTACACCATCCGGAGGTCAGCTAACTGTTTCAGCTTCCCTG AGGAAGGATCAGCTCGGGCGTTCTGTGCATCTTGCTAATCTAGA B TAATCCGGTATGCACCATCTCAAGAGTGGGTGGAGATCCATTTAAGCCAACTTTCAAAGCAAATGGCTGATGGA TTCGCCGCCATCCGCACAGA C GCATACGCTTCACGCCTGCATTGAGAGGATTGTGTGTCTCATTCAAGGTAATTGCACGGATAGAAGCTATAGGAAAAAGAATGAAAAGAGTCGAACTTGA A GATCAGGTTAACGCATACCGGAGCTGGGATACCTGAGTTTTTACTAAACCAAATGTTTGGGACT . . . GAGGAAGATGTGTCAGAAGAAGGATTGAGCTTA B ATTCAGAATGGCGTGTCCAGGTGAAGGTCTGCCTCCAGAGCTAGTCCGAGACATGTTCCATAGCAGCAGGTGG...ACAAGCCCTGAAGGTTTAGGTCTA C GTTCAGGATAATACACCCGGCACCAGGACTGCCTGAGGATCTGGTAAGAGAGATGTTTCAGCCTTTGAGAAAGGGAACATCAAGGGAAGGTTTGGGATTA A ATGGTTAGCCGGAAACTGGTGAAGCTGATGAAT...GGAGATGTTCAGTACTTGAGACAAGCTGGGAAATCAAGTTTCATTATCACTGCGGAACTCGCTG B AGCGTATGTCGAAAGATTTTAAAGCTAATGAAC...GGTGAGGTTCAATACATCCGAGAATCAGAACGGTCCTATTTCCTCATCATTCTGGAACTCCCTG C CACATTACCCAGAAGCTGGTGAAACTCATGGAGAGAGGAACATTGAGATACCTCAGAGAGTCTGAAATGTCAGCCTTTGTGATCCTCACAGAATTTCCCT *C *A *B 3700 A CAGC:AAACAA(^AGtrCCCCAAAAGAAAAGGGGTCTGGCTTGATATAAAATAGTCACTGGTTGTTCTTTGCTTGTAACTTTCCTTATCGCTTTT6TTTTCG B TACCTCGAAAGCGACCATTGTCAACTGCTAGTGGAAGTGGTGACATGATGCTGATGATGCCATA'ifrAGtrCACACTTCAGTTGGTATGAGAGTTTGTATCA C fTG^TTGAAGCTGAAGACCTGTCTACAAGATTTACATTTTATTGAATAAGTGTGGTGTTTTTGAAAGTCTTCATTTTTTTTTCTCACATATATAAATGTA PRIMER C PRIMER A 3800 A TTTTraaATTTrftGTAArGATGannTaTrraTrraTTTftraTrTTrTP;TTF;ARrTrTTTTrTGAAGrTGTAAATATGGATGCATATCTAATCTC(AAA..) B TTGTATGAGTGTTTGTGTGTCTAACGACGTCGGAGGAGGATAGAAAGTTTTTTTTTTGTTTCCGGTGAGATTAGTAGAGAAGAGGGAGATTATTTGCGTT C TGTTTAGTTACCGTAACTTAATTACATATATATATATAGGAAAGTTAAATTTG(AAA..) PRIMER B B CAGCTCAGCTCGCCGGAAAAAAAACGTAACAGTAGTTGTAGAGAATTTCAAGACTTTTGTTTGTGCTGTGTAAATTGACAACTCCGAGAGAAACAAAACA B ATGAGAT(AAA..) Figure 2. {See p. 1750 for legend.) GENES & DEVELOPMENT 1749 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shanock and Quail 1 50 100 A MSGSRPTQSSEGSRRSRHSARIIAQTTVDAKLHADFE...ESGSSFDYSTSVRVTGPWENQPPR B MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTT....YGSSV C MSSNTSRSCSTRSRQNSRVSSQVLVDAKLHGNFE...ESERLFDYSASINLNMPSSSCEIPS Cons S Q VDA LH FE ES FDYS S 15 0 200 A SDKVTTTYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENASELLTMASHAVPSVGEHPVLGIGTDIRSLFTAPSASALQKALGFGDVSLLNPILVHCRT B PEQQITAYLSRIQRGGYIQPFGCMIAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAMGTDVRSLFTSSSSILLERAFVAREITLLNPVWIHSKN C SA..VSTYLQKIQRGMLIQPFGCLIWDEKNLKVIAFSENTQEMLGLIPHTVPSMEQREALTIGTDVKSLFLSPGCSALEKAVDFGEISILNPITLHCRS Con s YL IQ G IQPFGC DE I SEN E L VP L GTD SLF L A LNP H 25 0 300 A SAKPFYAIIHRVTGSIIIDFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMVQEVFELTGYDRVMAYKFHEDDHGEWSEVTKPGLE B TGKPFYAILHRIDVGWIDLEPARTEDPALSIAGAVQSQKLAVRAISQLQALPGGDIKLLCDTWESVRDLTGYDRVMVYKFHEDEHGEWAESKRDDLE C SSKPFYAILHRIEEGLVIDLEPVSPDEVPVTAAGALRSYKLAAKSISRLQALPSGNMLLLCDALVKEVSELTGYDRVMVYKFHEDGHGEVIAECCREDME Con s KPFYAI HR IDLEP AGA S KLA I LQ LP G LCD V V LTGYDRVM YKFHED HGEV E E 35 0 * 400 A PYLGLHYPATDIPQAARFLFMKNKVRMIVDCNAKHARVLQDEKLSFDLTLCGSTLRAPHSCHLQY^4ANMDSIASLVMAVVVNEEDGEGDAPDATTQPQKR B PYIGLHYPATDIPQASRFLFKQNRVRMIVDCNATPVLWQDDRLTQSMCLVGSTLRAPHGCHSQYMANMGSIASLAMAVIINGNEDDGSNVASG...RSS C PYLGLHYSATDIPQASRFLFMRNKVRMICDCSAVPVKWQDKSLSQPISLSGSTLRAPHGCHAQYMSNMGSVASLVMSVTINGSDSDEMNRDL....QTG Con s PY GLHY ATDIPQA RFLF N VRMI DC A V QD L L GSTLFIAPH CH QYM NM S ASL M V N 450 500 A KRLWGLWCHNTTPRFVPFPLRYACEFLAQVFAIHVNKEVELDNQMVEKNILRTQTLLCDMLMRDAPLGIVSQSPNIMDLVKCDGAALLYKDKIWKLGTT B MRLWGLWCHHTSSRCIPFPLRYACEFLMQAFGLQLNMELQLALQMSEKRVLRTQTLLCDMLLRDSPAGIVTQSPSIMDLVKCDGAAFLYHGKYYPLGVA C RHLWGLWCHHASPRFVPFPLRYACEFLTQVFGVQINKEAESAVLLKEKRILQTQSVLCDMLFRNAPIGIVTQSPNIMDLVKCDGAALYYRDNLWSLGVT Cons LWGLWCH R PFPLRYACEFL Q F N E EK L TQ LCDML R P GIV QSP IMDLVKCDGAA Y LG 55 0 600 A PSEFHLQEIASWLCEYHMDSTGLSTDSLHDAGFPRALSLGDSVCGMAAVRISSKDMIFWFRSHTAGEVRWGGAKHDPDDRDDARRMHPRSSFKAFLEWK B PSEVQIKDWEWLLANHADSTGLSTDSLGDAGYPGAAALGDAVCGMAVAYITKRDFLFWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFQAFLEWK C PTETQIRDLIDWVLKSHGGNTGFTTESLMESGYPDASVLGESICGMAAVYISEKDFLFWFRSSTAKQIKWGGARHDPNDR.DGKRMHPRSSFKAFMEIVR Con s P E W H TG T SL G P A LG CGMA I D FWFRS TA WGGA H P D D RMHPRSSF AF E V 65 0 VOO A TRSLPWKDYEMDAIHSLQLILRNAFKDSETT...DVNTKVIYSKLNDLKIDGIQELEAVTSEMVRLIETATVPILAVDSDGLVNGWNTKIAELTGLSVDE B SRSQPWETAEMDAIHSLQLILRDSFKESEAAMNSKWDGWQPCRDMAGEQGIDELGAVAREMVRLIETATVPIFAVDAGGCINGWNAKIAELTGLSVEE C WKSVPWDDMEMDAINSLQLIIKGSLQEEHS KTWDVPLVDNRVQKVDELCVIVNEMVRLIDTAAVPIFAVDASGVINGWNSKAAEVTGLAVEQ Con s S PW EMDAI SLQLI V EL EMVRLI TA VP I AVD G NGWN K AE TGL V 75 0 800 A AIGKHFLT.LVEDSSVEIVKRMLENALEGTEEQNVQFEIKTHLSRADAGPISLWNACASRDLHENWGVCFVAHDLTGQKTVMDKFTRIEGDYKAIIQN B AMGKSLVSDLIYKENEATVNKLLSRALRGDEEKNVEVKLKTFSPELQGKAVFVVVNACSSKDYLNNIVGVCFVGQDVTSQKIVMDKFINIQGDY?CAIVHS C AIGKP.VSDLVEDDSVETVKNMLALALEGSEERGAEIRIRAFGPKRKSSPVELWNTCCSRDMTNNVLGVCFIGQDVTGQKTLTENYSRVKGDYARIMWS Con s A GK L V L AL G EE WN C S D N GVCF D T QK GDY I 85 0 900 A PNPLIPPIFGTDEFGWCTEWNPAMSKLTGLKREEVIDKMLLGEVFGTQKSCCRLKNQEAFVNLGIVLNNAVTSQ.DPDKVSFAFFTRGGKYVECLLCVSK B PNPLIPPIFAADENTCCLEWNMAMEKLTGWSRSEVIGKMIVGEVFG...SCCMLKGPDALTKFMIVLHNAIGGQ.DTDKFPFPFFDRNGKFVQALLTANK C PSTLIPPIFITNENGVCSEWNNAMQKLSGIKREEWNKILLGEVFTTDDYGCCLKDHDTLTKLRIGFNAVISGQKNIEKLLFGFYHRDGSFIEALLSANK Con s P LIPPIF E C EWN AM KL G R EV K GEVF CLK I QKFFRG LLK 95 0 1000 A KLDRKGWTGVFCFLQLASHELQQALHVQRLAERTAVKRLKALAYIKRQIRNPLSGIMFTRKMIEGTELGPEQRRILQTSALCQKQLSKILDDSDLESII B RVSLEGKVIGAFCFLQIPSPELQQALAVQRRQDTECFTKAKELAYICQVIKNPLSGMRFANSLLEATDLNEDQKQLLETSVSCEKQISRIVGDMDLESIE C RTDIEGKVTGVLCFLQVPSPELQYALQVQQISEHAIACALNKLAYLRHEVKDPEKAISFLQDLLHSSGLSEDQKRLLRTSVLCREQLAKVISDSDIEGIE Con s G V G CFLQ S ELQ AL VQ LAY P F LQLTSCQ DDEI 105 0 1100 A EGCLDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVMSDTLYGDSIRLQQVLADFMLMAVNFTPSGGQLTVSASL..RKDQLGRSVHLANLEI B DGSFVLKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRYAPSQEWVEIHLSQLSKQMADG..FAAIRTEF C EGYVELDCSEFGLQESLEAWKQVMELSIERKVQISCDYPQEVSSMRLYGDNLRLQQILSETLLSSIRFTPALRGLCVSFKVIARIEAIGKRMKRVELEF Con s GLEFLAQ M ESGDRQQLL P G E 1150 1187 A RLTHTGAGIPEFLLNQMFGT.EEDVSEEGLSLMVSRKLVKLMN.GDVQYLRQAGKSSFIITAELAAANK B RMACPGEGLPPELVRDMFHSSRW.TSPEGLGLSVCRKILKLMN.GEVQYIRESERSYFLIILELPVPRKRPLSTASGSGDMMLMMPy C RIIHPAPGLPEDLVREMFQPLRKGTSREGLGLHITQKLVKLMERGTLRYLRESEMSAFVILTEFPLI Cons R G P L MF S EGL L K KLM G Y R S F I E Figure 2. [A] Nucleotide sequences of the cDNA inserts from \A2-3(phyA), \A7-5{phyB], and XAl-l(phyC). The coding regions of the three sequences have been aligned so that they correspond to the peptide sequence alignment in B. Because the initiator ATG codons for the three sequences do not line up in this alignment, the first nucleotide of the phyB cDNA sequence has arbitrarily been given position 1. The initiator ATG codons for the phytochrome ORFs are boxed and marked above the alignment M^ith an asterisk. Termi­ nation codons are also boxed and marked. Sequences at the 3 ' ends of the cDNAs, to which antisense synthetic oligonucleotides were armealed and elongated to make transcript-specific hybridization probes, are underlined and labeled. Primer A was elongated to a Pstl site at position 3598, primer B to an Rsal site at position 3601, and primer C to a PflMl site at position 3512 (see Materials and methods). URFs at the 5' ends of the cDNAs are underlined and labeled. [B] Polypeptide sequences of phyA, phyB, and phyC were deduced from the nucleotide sequences in A. The polypeptides have been aligned in such a way as to maximize homology. Residues conserved in all three polypeptides are shown below the alignment. The cysteine residue (361) that corresponds to the chromophore attachment site identified in purified oat phytochrome is indicated by an asterisk. 1750 GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochiotnes in Arabidopsis Table 1. Percent amino acid sequence identity among idues in the alignment, including gaps and amino- and phytochromes from various plant species and A. thaliana carboxy-terminal extensions. These values are displayed phyA, B, and C in the lower left of Table 1, below the diagonal, and are an index of the degree of structural relatedness of the phyA phytochromes paired polypeptides. Second, the number of identical monocot dicot amin o acids has been divided by the numbe r of residues oat rice :om zucchini pea ;: hyj 4 phyB phyC in the shorter of the two sequences, ignoring gaps and extension s (Table 1, upper right above the diagonal). Oat 89 88 -64- 64 I 48 Values calculated in this way provide an index of the Rice 89 88 164 65 64 49 exten t of evolutionary relatedness of the paired se­ Com 88 88 quences (DooUttle 1981; Feng et al. 1985). These two 'L_64 65 64 48 method s of calculation yield only minor differences in "6 3 ~ -64- Zucchini '63^ |78 52 79 51 th e values obtained, and these differences are not con­ Pea 64 64 78 — 79 51 52 sidered further here. Th e values determined (Table 1) in­ dicate that all previously described phytochrome poly­ phyA , 63 63j 79 — 79 52 52 peptides are significantly more related to th e A. thaliana phyB 46 49 48 49 51 phyA protein than to phyB and phyC. These previously phyC 48 48 48 51 51 characterized sequences correspond to the abundant 52 49 etiolated-tissue phytochromes in these species and are For each pair of aligned sequences, the number of identical res­ very likely functional homologs of one another. We pro­ idues was divided either by the total number of positions in the pose that the designation phyA be extended to these se­ alignment, including gaps and extensions, (below the diagonal) quences . Withi n this group, the three monoco t phyA se­ or by the number of amino acids in the shorter of the two se­ quences are highly related to each other (88-89% iden­ quences (above the diagonal) and expressed as a percent. Values tical), the three dicot phyA sequences are less related to derived for comparisons within monocot or dicot phyA se­ quences are boxed; values for comparisons between monocot each other (78-79% identity), and comparisons across and dicot sequences are enclosed by dashed lines. References monocot/dico t lines show 63-65 % identity. These re­ for previously published phytochrome sequences are oat (Her- sult s are similar, in general, to results obtained for phy- shey et al. 1985), rice (Kay et al. 1989a), corn (Christensen and logenetic comparison of glyceraldehyde-3-phosphate de­ Quail 1989), zucchini (Sharrock et al. 1986), and pea (Sato 1988). hydrogenase and chalcone synthase sequences from various angiosperm plant species (Martin et al. 1989). In contrast, the Arabidopsis phyB and phyC sequences are uniqu e in that they are equivalently and highly diver­ been aligned, and the percent identical residues in each gent from each other and from all of the phyA phy­ pairwise combination has been calculated in two ways. tochrome s (Table 1). First, the number of identical amino acids has been di­ Th e data in Table 1 can be interpreted most readily as vided by the total number of positions occupied by res­ AMINO ACID RESIDUES 400 600 800 COOH Figure 3. Local level of amino acid sequence identity for the three pairwise alignments of phyA, phyB, and phyC. The number of identical residues within a window of 9 amino acids is expressed as percent identity and plotted at the middle position of the window. Gaps in the alignment in Fig. 2B are counted as mismatches. Shaded areas correspond to regions of >50% identity. A schematic representation of the longest polypeptide, phyB, is shown below the plots, indicating the position of the chromophore attachment site. GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shaiiock and Quail HYDROPHOBIC HYDROPHILIC AMINO AaO RESIDUES Figure 4. Hydropathy profiles of phyA, phyB, and phyC. Hydropathy analysis was performed according to Kyte and Doolittle (1982), using a window of 9 amino acids. The profiles have been aligned in the same way as the sequences in Fig. 2B, with gaps introduced at the same position. defining a phylogenetic tree containing a tripartite clones (see Materials and methods, Figs. 1 and 2A) to branching of the three major phytochrome types (A, B, determine the patterns of expression of the three phy­ and C) from a precursor gene followed by subsequent di­ tochrome genes. The transcript-specific probes detect vergence of the phyA genes (Fig. 5). Parsimony analysis unique bands on total A. thaliana DNA Southern blots using the PHYLIP programs of Felsenstein (1985) of the (Fig. IB). When hybridized to Northern blots of total nucleotide sequences for the eight phytochrome genes RNA isolated from 5-day-old A. thahana seedlings yields an unrooted phylogenetic tree, consistent with grown imder various light conditions, all three probes that shown in Figure 5 (R. Sharrock and P. Quail, un- detect RNAs 4.0-4.4 kb in length (Fig. 6), consistent publ.). The tree indicates that the trifurcation of the with the sizes of the cDNAs that were isolated (3.6-3.8 phytochrome gene family into types A, B, and C is an kb). ancient evolutionary event. If the branch point for diver­ The level of phyA mRNA is high in dark-grown tissue, gence of the monocot and dicot phyA sequences in is not strongly affected by a pulse of red light, but is Figure 5 corresponds to the divergence of the monocots markedly reduced within a few hours after transfer to and dicots during angiosperm evolution, 100-300 mil­ white light (Fig. 6). In addition, the phyA probe hy­ lion years ago (Lidgard and Crane 1988; Martin et al. bridizes to more than one RNA transcript. The lower 1989), the gene duplication events that gave rise to molecular weight (4.0 kb) phyA transcript appears to be phyA, phyB, and phyC occurred before that, much ear­ strongly down-regulated by white light, whereas the lier in the evolution of vascular plants. higher molecular weight (4.4 kb) transcript is clearly vis­ ible only in the white light-irradiated sample (Fig. 6). A situation similar to this has been described for the gene Expression of the phyA, phyB, and phyC mRNAs encoding the phyA homolog in pea, where the multiple We used transcript-specific ssDNA hybridization probes transcripts were shown to be the result of transcription derived from sequences at the 3' ends of the cDNA initiation at multiple start sites within a complex pro- • Oat phy3 • Rice phy18 • Corn phyA1 • Zucchini phy • Pea phy Precursor _ • Arabidopsis phyA Phytochrome Figure 5. Deduced phylogeny of phytochrome poly­ • Arabidopsis phyB peptides. Percent amino acid sequence identity be­ tween each pairwise combination of phytochromes • Arabidopsis phyC (Table 1, values above the diagonal) was used to I I I I I group related sequences and as a measure of phyloge­ 50 60 70 80 90 100 netic distance in constructing the tree. % Amino Acid Sequence Identity GENES & DEVELOPMENT 1752 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochromes in Arabidopsis moter (Sato 1988). A complex promoter structure analo­ White Light gous to the pea phyA promoter is located upstream of 1 3 5 CONT. D R the A. thaliana phyA gene (R. Sharrock and P. Quail, FR kb unpubl.). The A. thaliana phyB and phyC mRNAs are .4.4 less abundant than the phyA mRNA in dark-grown ^ ^ -^ phyA 4.0 ••« • tissue (5-10%) and are not strongly regulated by the light conditions tested, although the phyB transcript level shows a small transient increase following transfer to white light (Fig. 6). phyB — 4.0 Discussion We used the technique of low stringency hybridization to identify and isolate A. thaliana cDNA clones that are 4.0 phyC related to the red light-responsive photoreceptor phy- tochrome and presented the sequences of three such cDNAs and their derived polypeptides. These sequences Figure 6. Blot hybridization analysis of the phy mRNAs include the A. thaliana homolog of the previously char­ present in total RNA from A. thaliana seedlings. RNA was iso­ acterized abundant etiolated-tissue phytochrome (phyA) lated from seedlings that were grown for 5 days completely in and identify two new classes of phytochrome apopro­ the dark (D), given a pulse of red (R) or red followed by far red teins (phyB and phyC). In addition to these three pro­ light (R/FR) 3 hr prior to harvest, transferred to white light for teins, there is evidence from DNA blot analysis for the 1, 3, or 5 hr prior to harvest, or grown for 5 days in continuous white light (CONT). Blots were probed with the ssDNA tran­ presence of one or two additional related sequences in script-specific probes for the phyA, phyB, and phyC mRNAs the A. thaliana genome. We propose that A. thaliana (Fig. 1). Transcript sizes were estimated from mobility relative contains a family of at least three, and potentially five, to RNA molecular weight standards. phytochrome genes whose products are diverse, red light-responsive regulatory photoreceptors. This pro­ posal has implications for the mechanism of regulatory light perception in all plants. Hormone and growth factor receptors in animal systems are frequently terization of the chromophore-containing forms of these members of gene families or superfamilies that encode proteins. The levels of phyB and phyC mRNA detected numerous related receptor structures (Evans 1988; in etiolated A. thaliana seedlings indicate that the phyB Yarden and Ullrich 1988). Structural homology within and phyC proteins are likely to be less abundant than these families reflects general similarity in their mode of phyA phytochrome in this tissue. Previously, there have action, such as conserved DNA-binding or protein ki­ been several reports of low-abundance, green-tissue nase domains, whereas differential activities of indi­ forms of phytochrome in oat and pea that are immimo- vidual members of the families likely result from varia­ chemically and spectrally distinct from the major, etio­ tions in ligand specificity, restricted tissue or cell-type lated-tissue form (Abe et al. 1985; Shimazaki and Pratt localization, or different pathways of cellular activation. 1985; Tokuhisa et al. 1985). It is possible that phyB for By analogy, the family of homologous but markedly di­ phyC corresponds to this low abundance phytochrome vergent phytochrome polypeptides that we have de­ or, alternatively, that the partially purified chromopro­ scribed share structural features but may perform widely tein fractions from oat and pea are mixtures of the ho­ different roles in the regulation of higher plant photo- mologs of phyA, phyB, and phyC in these plant species. morphogenesis. These questions can now be approached using antisera specific to the A, B, and C forms of phytochrome. Analysis of the previously published sequences of phytochrome from oat, rice, corn, zucchini, and pea in­ Phytochrome has been detected spectrally in all an- dicates that these proteins are all homologs of the A. giosperm and gymnosperm plants that have been exam­ thaliana phyA gene product. The relatively abundant ined, in ferns and bryophytes, and in some species of phyA phytochrome from dark-grown plant tissue is a algae (Correll et al. 1977). Currently, sequence informa­ chromoprotein that exists in two spectrally distinct tion is available only for phytochrome from a few angio- confirmations, Pj and Pf^, and photoconversion between sperm genera. Comparison of these sequences shows these two conformations underlies the role of phy­ that the origins of the phyA, phyB, and phyC genes were tochrome as a regulatory molecule. The phyB and phyC very likely gene duplications that occurred early in higher plant evolution, long before the divergence of the gene products contain regions of high sequence simi­ two major groups of angiosperms, the monocots and larity to phyA phytochrome, notably at and around the dicots. This expansion and divergence of the phy- chromophore attachment site, and the calculated hydro­ tochrome-coding capacity may have accompanied emer­ pathic properties of the three proteins are very similar. gence of novel mechanisms of regulation of photomor- Though this strongly suggests that phyB and phyC are phogenesis in early plants. The ancient origins of the indeed apoproteins for red/far red light-responsive pho­ phytochrome gene family also indicate the. phyA, phyB, toreceptors, rigorous proof of this awaits spectral charac- GENES & DEVELOPMENT 1753 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Sharrock and Quail and phyC homologs are likely to be present in all angio- phyA, the phyB and phyC mRNAs are present at low sperms and, perhaps, all higher plants. Though pub­ levels and are not significantly light-regulated. The pre­ lished data have been interpreted as indicating the pres­ dominance of phyA mRNA in dark-grown tissue indi­ ence of only a single phytochrome gene in pea (Sato cates that the phyA receptor is likely to be the most 1988) and in rice (Kay et al. 1989b), these studies were abundant phytochrome in etiolated seedlings and may performed using hybridization conditions that would play a specific role in the de-etiolation process. In fully not favor detection of distantly related sequences. Pre­ green plant tissue, the levels of the mRNAs for the three viously, we presented evidence for multiple phy- photoreceptors are within severalfold of each other, tochrome-related sequences in DNA blots of tomato making it less likely that one phytochrome is physically (Sharrock et al. 1988). If the A, B, and C forms of phy­ or functionally predominant. tochrome are conserved elements of higher plant pho- Though the phyA gene is the only member of the Ara­ toregulation systems, the roles of these receptors in the bidopsis phytochrome family that has been shown to be regulation of photomorphogenesis in A. thaliana may regulated at the level of mRNA abundance, all three phy also be conserved across a wide range of plant genera. mRNAs contain URFs in their 5'-leader regions, pre­ Amino acid identity profiles of the phyA, phyB, and ceding the initiator AUG for the phytochrome-coding phyC sequences aligned in the three possible pairwise sequence. These URFs contain 3-12 in-frame codons combinations indicate that similar regions of the three before a translation termination codon is reached. Most polypeptides have been conserved and that no deletion, eukaryotic mRNAs do not contain URFs (Kozak 1987), replacement, or rearrangement of large structural do­ and, in some cases, mRNAs that contain URFs show mains has occurred. Notable deviations from this con­ complex translational regulation. For example, Mueller served structure are the 3 5-residue amino-terminal and and Hinnebush (1986) demonstrated that the four 5'- 11-residue carboxy-terminal extensions of the phyB leader URFs in the yeast GCN4 mRNA have strong reg­ polypeptide. As was observed in comparison of phyA se­ ulatory effects on translation of the downstream coding quences from monocot and dicot plant species (Sharrock sequences. All dicot phytochrome 5' leaders that have et al. 1986), the largest blocks of amino acid sequence been sequenced, including phyA from zucchini (Shar­ conserved among phyA, phyB, and phyC (Figs. 2B and 3) rock et al. 1986), pea (Sato 1988), and Arabidopsis and are at and around the cysteine residue (position 361 in phyB and phyC, contain at least one URF. Moreover, the Fig. 2B), which serves as the chromophore attachment multiple phyA mRNA 5' ends encoded by the complex site (Lagarias and Rapoport 1980). Native phyA phy­ phyA promoters of pea (Sato 1988) and Arabidopsis (R. tochrome is purified from the soluble fraction of plant Sharrock and P. Quail, unpubl.) contain differing extracts (Vierstra and Quail 1983) and appears, by immu- numbers of URFs, from one URF in the shortest 5'-un­ nocytochemistry, to be distributed evenly in the cyto­ translated sequence to four URFs in the longest. Mon­ plasm of etiolated-tissue cells (McCurdy and Pratt 1986; ocot phytochrome 5' leaders, including phyA from oat Saunders et al. 1983). From consideration of the hydro­ (Hershey et al. 1985), rice (Kay et al. 1989a), and com pathic properties of the proteins (Fig. 4), Arabidopsis (Christensen and Quail 1989), do not contain URFs. phyB and phyC also appear to be soluble proteins, and Hence, it is possible that regulation of dicot phy­ although phytochrome modulation of membrane proper­ tochrome gene expression, including all members of the ties and physical association of phytochrome with gene family, includes a component of translational regu­ membranes or plastids have been reported (for review, lation that is not present in monocots. see Roux 1986), no membrane-spaiming or transit pep­ The biology of receptor systems in plants is poorly un­ tide sequences are predicted within the phyB and phyC derstood as compared to such systems in animals. The proteins. mechanisms through which physical and chemical In addition to encoding divergent polypeptides, the A. signals are perceived and transmitted in plants may be thahana phyA, phyB, and phyC genes are expressed in related to mechanisms that operate in animal receptor different ways, quantitatively and qualitatively. Tran­ systems or they may be unique. In the case of the phy­ scripts for all three phytochromes are detected in RNA tochrome system, absorption of a photon of light by a from 5-day-old seedlings and are represented in a cDNA soluble chromoprotein receptor triggers a diverse and library made from RNA from 3-week-old rosette leaves. complex array of growth and developmental responses. The phyA mRNA is the most abundant of the three in The discovery of multiple phytochrome genes in A. tha­ dark-grown (etiolated) tissue and is down-regulated in hana suggests that, as in many animal receptor systems, the presence of white light. Light-induced down-regula­ diversity of response in plant light perception may re­ tion of phyA mRNA abundance has been described in flect heterogeneity of receptor structure and differential several plant species. In monocots, this effect is rapid patterns of expression of a family of receptor genes. With and pronounced, is mediated by the phytochrome the identification and characterization of the phyA, system itself (Colbert et al. 1985), and is, in large part, phyB, and phyC phytochromes, we are now in a position due to reduced transcription of phyA genes (Lissemore to develop peptide-specific antisera, determine the and Quail 1988). In dicots, down-regulation of phyA tissue localization of the various phytochromes, and mRNA is less pronounced (Lissemore et al. 1987; Sato begin analysis of the functions of these gene products 1988) and, in the case of Arabidopsis, appears to require using classical and molecular genetic approaches in Ara­ the presence of continuous white light. In contrast to bidopsis. GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochromes in Arabidopsis Materials and methods Library screening An amplified XgtlO library of size-fractionated (3- to 6-kb frac­ Plant material and growth conditions tion) A. thaliana cDNAs was supplied by N. Crawford (Univer­ All experiments were performed using A. thaliana land race sity of California, San Diego). The cDNA was prepared from Columbia. Seeds were purchased from Guhy's Nursery poly(A)+ RNA isolated from rosette leaves of plants grown (Tucson, Arizona). Plants used for preparation of DNA were 16-20 days under continuous illumination (Crawford et al. grown for 3 weeks in soil at 24°C under fluorescent light. For 1988). Approximately 250,000 recombinant phage were plated, preparation of RNA, -5000 seeds were sterihzed for 60 min in and the plaques were transferred to nitrocellulose using stan­ 20% bleach/0.2% SDS and washed six times in sterile water. dard methods (Maniatis et al. 1982). Filters were prehybridized Sterile seeds were distributed onto a Whatman No. 1 filter and hybridized with the 0.9-kb coding-region probe in 30% paper disk overlaying 0.8% agar/0.5 x Murashige-Skoog salts formamide buffers and were washed at low stringency, as de­ (Difco) in a 150 X 25-mm petri dish and placed at 4°C in com­ scribed above for DNA blots. Prospective phytochrome-related plete darkness. After 7 days, the seeds were brought to room clones were plaque-purified, and phage DNA was prepared for temperature and irradiated for 10 min with white light. The subcloning (Grossberger 1987). plates were sealed, wrapped in foil, and incubated for 5 days at 24°C in the dark. Under these conditions, seed germination was >90% and etiolated seedlings were ~1 cm tall. Irradiation of RNA preparation and analysis 5-day-old seedings was performed at 24°C for periods of 5 min with red or far red light (Lissemore et al. 1987). Seedlings were All RNA preparation procedures were carried out on ice, using harvested 3 hr after irradiation and frozen in liquid N^. White baked glassware and solutions treated with diethylpyrocar- light irradiation was performed under fluorescent bulbs at 24°C bonate. Phenol/isoamyl alcohol/chloroform 25 : 1 : 25 (PIC) for the indicated times. The outputs of the red, far red, and was equilibrated four times with 100 mM Tris-HCl (pH 8.3) and white light sources were 8 W/m^, 11 W/m^, and 28 W/m^, re­ 10 mM EDTA. RNA was prepared from 1-3 grams fresh weight spectively, as measured by an EG&G Gamma Scientific model whole plant A. thaliana tissue. Frozen tissue was ground to a 550-1 radiometer/photometer. powder in liquid Nj in a mortar and pestle, transferred to a 30-ml Corex tube containing 5 ml of extraction buffer [50 mM Tris-HCl (pH 8.3), 150 mM NaCl, 10 mM EDTA, 1% lauryl sar- cosine], and mixed with a Polytron at low speed. An equal volume of PIC was then added, and the sample was mixed with Plant DNA preparation and analysis the Polytron at high speed for 1 min. After centrifugation, the Total A. thaliana DNA was prepared by the method of Au- aqueous phase was extracted three more times with PIC, and subel et al. (1989). Samples containing 3 |xg of DNA were di­ the nucleic acids precipitated with Na acetate/ethanol. The gested with restriction enzymes, separated on 0.8% agarose precipitates were dissolved in 10 mM Tris-HCl (pH 8.3) and 10 gels, and transferred to GeneScreen Plus (Dupont) hybridization mM EDTA, and RNA was precipitated twice with 2 M LiCl, the membranes according to procedures recommended by the man­ first time overnight on ice in a total volume of 4 ml and the ufacturer. Blots probed with the 0.9-kb coding-region probe (Fig. second time for 5-6 hr in a volume of 2 ml. The RNA pellet 1) were prehybridized for 12 hr at 42°C in 30% formamide, 5 x was dissolved in 0.27 ml HjO and ethanol-precipitated. RNA SSC, 5 X Denhardt's solution, 40 mM NaP04 (pH 6.8), 0.5% yields were 80-100 |xg of RNA per gram of tissue for etiolated BSA, 1% SDS, and 100 M-g/ml sonicated denatured salmon seedlings and 150-300 |xg of RNA per gram of tissue for green testes DNA and subsequently hybridized to the probe for 18 hr seedlings. at 42°C in 30% formamide, 5x SSC, 40 mM NaP04 (pH 6.8), Samples of total RNA (5 jjig) were separated by electropho­ 10% dextran sulfate (M, = 500,000), and 100 jjig/ml soni­ resis in 0.8% agarose/3% formaldehyde gels containing 20 mM cated denatured salmon testes DNA. These membranes were NaP04 (pH 6.8) and transferred to GeneScreen hybridization washed under low-stringency conditions: twice for 20 min at membranes (Dupont), using procedures recommended by the room temperature and once for 1 hr at 60°C in 2 x wash solu­ manufacturer. Membranes were prehybridized and hybridized tion (2x SSC, 5 mM EDTA, 1.5 mM sodium pyrophosphate, to the gene-specific ssDNA probes A, B, and C (Fig. 1) in 50% 0.5% SDS). Blots hybridized with transcript-specific probes formamide buffers and were washed at high stringency as de­ (probes A, B, C, Fig. 1) were treated in the same way, except the scribed above for DNA blots. prehybridization and hybridization buffers contained 50% formamide and the final wash was for 1 hr at 65°C in 0.1 x wash solution (high-stringency conditions). Autoradiography DNA sequencing and sequence analysis was done at - 70°C with an intensifying screen. The coding-region hybridization probe (0.9-kb probe; Fig. 1) The cDNA inserts from clones XA2-3, \A1-1, and X.A7-5 were was a ^^P-labeled, ssDNA synthesized from a recombinant subcloned into M13mpl8 and sequenced completely in both di­ M13mpl8 (Yanisch-Perron et al. 1985) phage containing a 925- rections by the dideoxy method (Sanger et al. 1977), using syn­ bp Pstl fragment of A. thaliana phytochrome-coding sequence. thetic oligonucleotides as primers. DNA and polypeptide se­ Preparation of this probe has been described (Sharrock et al. quence analysis and alignment were performed using the pro­ 1988). Transcript-specific ssDNA probes were prepared using as grams of the UWGCG Software Package (Devereux et al. 1984). template sense-strand ssDNA of M13mpl8 clones of the most Gaps in the aligned polypeptide sequences (Fig. 2B) were intro­ 3 ' £coRI fragments of the phyA, phyB, and phyC cDNA inserts duced according to the BESTFIT program and by eye and are (Fig. 1). Synthetic oligonucleotides, annealed to these templates parsimonious in that the number of gaps introduced to opti­ just upstream of the poly(A) tails (Fig. 2A), were extended with mize sequence similarity have been kept to a minimum. Gaps Klenow fragment in the presence of [^^pjdCTP, truncated with in the nucleotide sequence (Fig. 2A) were introduced at posi­ PstliphyA), Rsal(phyB], or PflMl{phyC), and the labeled single- tions corresponding to the gaps in the peptide sequences. stranded DNAs were purified from denaturing gels as described Alignment of the eight available phytochrome polypeptide se­ (Sharrock et al. 1988). quences (Table 1) was done using the BESTFIT and LINEUP GENES & DEVELOPMENT 1755 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shatiock and Quail programs and by eye. Parsimony analysis of 325 phylogenetic- gene products expressed in etiolated Avena. Nucleic Acids ally informative sites in the phytochrome nucleic acid se­ Res. 13: 8543-8559. quences was performed using the programs of Felsenstein Hillman, W.S. 1967. The physiology of phytochrome. Annu. (1985). Rev. Plant Physiol. 18: 301-324. Jabben, M. and M.G. Holmes. 1983. Phytochrome in light- grown plants. In Photomorphogenesis. Encyclopedia of plant physiology, new series, vol. 16B (ed. W. Shropshire and H. Acknowledgments Mohr), pp. 704-722. Springer-Verlag, Berlin. We thank Dr. Nigel Crawford for his gift of the A. thaliana Jones, A.M. and P.H. Quail. 1986. Quaternary structure of 124- cDNA library, Jo Anne Welsch for excellent technical assis­ kilodalton phytochrome from Avena sativa L. Biochemistry tance, Susan DeSimoni and Dr. Christiana Gatz for their con­ 25: 2987-2995. tributions to the early phase of this work, and Drs. Sheila Kaufman, L.S., W.F. Thompson, and W.R. Briggs. 1984. Dif­ McCormick, Alan Christensen, and Tim Caspar for critical ferent red light requirements for phytochrome-induced ac­ reading of the manuscript. This work was supported by Depart­ climation of cab RNA and rbcs RNA. Science 226: 1447- ment of Energy grant DE-FG03-87ER13742 and U.S. Depart­ ment of Agriculture grant 85-CRCR-1-1578 to P.H.Q. R.A.S. Kay, S.A., B. Keith, K. Shinozaki, and N.-H. Chua. 1989a. The was the recipient of postdoctoral fellowship DMB-8508836 sequence of the rice phytochrome gene. Nucleic Acids Res. from the National Science Foundation. 17: 2865-2866. Kay, S.A., B. Keith, K. Shinozaki, M.-L. Chye, and N.-H. Chua. 1989b. The rice phytochrome gene: Structure, autoregulated expression, and binding of GT-1 to a conserved site in the 5' References upstream region. Plant Cell 1: 351-360. Abe, R , K.T. Yamamoto, A. Nagatani, and M. Furuya. 1985. Kozak, M. 1987. An analysis of 5'-noncoding sequences from Characterization of green tissue-specific phytochrome iso­ 699 vertebrate messenger RNAs. Nucleic Acids Res. lated immunochemically from pea seedlings. Plant Cell 20: 8125-8148. Physiol. 26: 1387-1399. Kronenberg, G.H.M. and R.E. Kendrick. 1986. The physiology Ausubel, F.M., R. Brent, R.E. Kingston, D.D. Moore, J.G. of action. In Photomorphogenesis in plants (ed. R.E. Ken­ Seidman, J.A. Smith, and K. Struhl, eds. 1989. Cunent pro­ drick and G.H.M. Kronenberg), pp. 99-114. Martinus Nij- tocols in molecular biology, pp. 2.3.1-2.3.3. Greene Pub­ hoff Publishers, Dordrecht. lishing Associates and Wiley-Interscience, New York. Kyte, J. and R.F. Doolittle. 1982. A simple method for dis­ Butler, A., A. Wei, K. Baker, and L. Salkoff. 1989. A family of playing the hydropathic character of a protein. /. Mol. Biol. putative potassium channel genes in Drosophila. Science 157: 105-132. 243: 943-947. Lagarias, J.C. and H. Rapoport. 1980. Chromopeptides from Christensen, A.H. and P.H. Quail. 1989. Structure and expres­ phytochrome. The structure and linkage of the P, form of sion of a maize phytochrome-encoding gene. Gene (in press). the phytochrome chromophore. /. Am. Chem. Soc. 102:4821-4828. Colbert, J.T., H.P. Hershey, and P.H. Quail. 1985. Phytochrome regulation of phytochrome mRNA abundance. Plant Mol. Lidgard, S. and P.R. Crane. 1988. Quantitative analysis of the early angiosperm radiation. Nature 331: 344-346. Biol. 5: 1-101. Correll, D.L., J.L. Edwards, and W. Shropshire, eds. 1977. Phy­ Lissemore, J.L. and P.H. Quail. 1988. Rapid transcriptional reg­ tochrome: A bibhography with author, biological mate­ ulation by phytochrome of the genes for phytochome and rials, taxonomic, and subject indexes of publications prior chlorophyll a/b binding protein in Avena sativa. Mol. Cell. Biol. 8: 4840-4850. to 1975. Smithsonian Institution Press, Washington, D.C. Crawford, N.M., M. Smith, D. BeUissimo, and R.W. Davis. Lissemore, J.L., J.T. Colbert, and P.H. Quail. 1987. Cloning of 1988. Sequence and nitrate regulation of the Arabidopsis cDNA for phytochrome from etiolated Cucurbita and coor­ thaliana mRNA encoding nitrate reductase, a metalloflavo- dinate photoregulation of the abundance of two distinct phytochrome transcripts. Plant Mol. Biol. 8: 485-496. protein with three fimctional domains. Proc. Natl. Acad. Sci. 85: 5006-5010. Mancinelli, A.L. and I. Rubino. 1978. The 'high irradiance' re­ Devereux, J., P. Haeberli, and O. Smithies. 1984. A comprehen­ sponses of plant photomorphogenesis. Bot. Rev. 44: 129- sive set of sequence analysis programs for the VAX. Nucleic 150. Acids Res. 12: 387-395 . Mandoli, D.F. and W.R. Briggs. 1981. Phytochrome control of Doolittle, R.F. 1981. Similar amino acid sequences: Chance or two low-irradiance responses in etiolated oat seedlings. common ancestry? Science 214: 149-159. Plant Physiol. 67: 733-739. Evans, R.M. 1988. The steroid and thyroid hormone receptor Maniatis, T., E.F. Fritsch, and J. Sambrook. 1982. Molecular superfamily. Science 240: 889-895. cloning: A laboratory manual. Cold Spring Harbor Labora­ Felsenstein, J. 1985. Confidence limits on phylogenies: An ap­ tory, Cold Spring Harbor, New York. proach using the bootstrap. Evolution 38: 783-791. Martin, W.F., A. Gierl, and H. Saedler. 1989. Molecular evi­ Feng, D.F., M.S. Johnson, and R.F. Doolittle. 1985. Aligning dence for pre-Cretaceous angiosperm origins. Nature amino acid sequences: Comparison of commonly used 339: 46-48 . methods. /. Mol. Evol. 21: 112-125. McCurdy, D.W. and L.H. Pratt. 1986. Immunogold electron mi­ croscopy of the phytochrome in Avena: Identification of in­ Giguere, V., N. Yang, P. Segui, and R.M. Evans. 1988. Identifi­ cation of a new class of steroid hormone receptors. Nature tracellular sites responsible for phytochrome sequestering 331: 91-94. and enhanced pelletability. /. Cell. Biol. 103: 2541-2550. Grossberger, D. 1987. Minipreps of DNA from bacteriophage Meyerowitz, E.M. 1987. Arabidopsis thaliana. Annu. Rev. lambda. Nucleic Acids Res. 15: 6737. Genet. 21:93-111 . Hershey, H.P., R.F. Barker, K.B. Idler, J.L. Lissemore, and P.H. Mueller, P.P. and A.G. Hirmebush. 1986. Multiple upstream Quail. 1985. Analysis of cloned cDNA and genomic se­ AUG codons mediate translational control of GCN4. Cell quences for phytochrome: Amino acid sequences for two 45: 201-207. 1756 GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochromes in Arabidopsis Yarden, Y. and A. Ullrich. 1988. Growth factor receptor tyro­ Ohno, S., Y. Akita, Y. Konno, S. Imajoh, and K. Suzuki. 1988. A sine kinases. Armu. Rev. Biochem. 57: 443-478. novel phorbol ester receptor/protein kinase, nPKC, distantly related to the protein kinase C family. Cell 53: 731-741. Roux, S.J. 1986. Phytochrome and membranes. In Photomor- phogenesis in plants (ed. R.E. Kendrick and G.H.M. Kronen- berg), pp. 115-136. Martinus Nijhoff Publishers, Dordrecht. Rudiger, W. and H. Scheer. 1983. Chromophores in photomor- phogenesis. In Photomorphogenesis. Encyclopedia of plant physiology, new series, vol. 16A (ed. W. Shropshire and H. Mohr), pp. 119-151. Springer-Verlag, Berlin. Salisbury, F.B. and C.W. Ross. 1985. Plant physiology. Wads- worth Publishing Company, Belmont. Sanger, F., S. Nicklen, and A.R. Coulson. 1977. DNA se­ quencing with chain-terminating inhibitors. Pioc. Natl. Acad. Sci. 74: 5463-5467. Sato, N. 1988. Nucleotide sequence and expression of the phy­ tochrome gene in Pisum sativum: Differential regulation by light of multiple transcripts. Plant Mol. Biol. 11: 697-710. Saunders, M.J., M.-M. Cordonnier, B.A. Palevitz, and L.H. Pratt. 1983. Immimofluorescence visualization of phytochrome in Pisum sativimi L. epicotyls using monoclonal antibodies. Planta 159: 545-553. Schaeffer, £., D. Smith, G. Mardon, W. Quinn, and C. Zuker. 1989. Isolation and characterization of two new Drosophila protein kinase C genes, including one specifically expressed in photoreceptor cells. Cell 57: 403-412. Sharrock, R.A., J.L. Lissemore, and P.H. Quail. 1986. Nucleo­ tide and amino acid sequence of a Cucuibita phytochrome cDNA clone: Identification of conserved features by com­ parison with Avena phytochrome. Gene 47: 287-295. Sharrock, R.A., B.M. Parks, M. Koomneef, and P.H. Quail. 1988. Molecular analysis of the phytochrome deficiency in an aurea mutant of tomato. Mol. Gen. Genet. 213: 9-14. Shimazaki, Y. and L.H. Pratt. 1985. Immunochemical detection with rabbit polyclonal and mouse monoclonal antibodies of different pools of phytochrome from etiolated and green Avena shoots. Planta 164: 333-344. Shropshire W. and H. Mohr, eds. 1983. Photomorphogenesis. Encyclopedia of plant physiology, new series, vol. 16A and 16B. Springer-Verlag, Berlin. Smith, H. 1986. The perception of light quality. In Photomor­ phogenesis in plants (ed. R.E. Kendrick and G.H.M. Kronen- berg), pp. 187-217. Martinus Nijhoff Publishers, Dordrecht. Thompson, C.C., C. Weinberger, R. Lebo, and R.M. Evans. 1987. Identification of a novel thyroid hormone receptor ex­ pressed in the mammalian central nervous system. Science 237: 1610-1614. Tokuhisa, J.G. and P.H. Quail. 1983. Spectral and immuno­ chemical characterization of phytochrome isolated from light-grown Avena sativa. (abstr.) Plant Physiol. Suppl. 72: 85. Tokuhisa, J.G., S.M. Daniels, and P.H. Quail. 1985. Phy­ tochrome in green tissue: Spectral and immunochemical ev­ idence for two distinct molecular species of phytochrome in light-grown Avenfl sativa L. Planta 164: 321-332 . Vierstra, R.D. and P.H. Quail. 1983. Purification and initial characterization of 124-kilodalton phytochrome from Avena. Biochemistry 22: 2498-2504. . 1986. The protein. In Photomorphogenesis in plants (ed. R.E. Kendrick and G.H.M. Kronenberg), pp. 35-60. Mar­ tinus Nijhoff Publishers, Dordrecht. Yanisch-Perron, C., J. Viera, and ]. Messing. 1985. Improved M13 phage cloning vectors and host strains: Nucleotide se­ quences of the M13mpl8 and pUC19 vectors. Gene 22:103 - GENES & DEVELOPMENT 1757 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochrome sequences in Arabidopsis thaliana: structure, evolution, and differential expression of a plant regulatory photoreceptor family. R A Sharrock and P H Quail Genes Dev. 1989, 3: Access the most recent version at doi:10.1101/gad.3.11.1745 This article cites 43 articles, 11 of which can be accessed free at: References http://genesdev.cshlp.org/content/3/11/1745.full.html#ref-list-1 License Receive free email alerts when new articles cite this article - sign up in the box at the top Email Alerting right corner of the article or click here. Service Copyright © Cold Spring Harbor Laboratory Press http://www.deepdyve.com/assets/images/DeepDyve-Logo-lg.png Genes & Development Unpaywall

Novel phytochrome sequences in Arabidopsis thaliana: structure, evolution, and differential expression of a plant regulatory photoreceptor family.

Genes & DevelopmentNov 1, 1989

Loading next page...
 
/lp/unpaywall/novel-phytochrome-sequences-in-arabidopsis-thaliana-structure-MrPtJor5X1

References

References for this paper are not available at this time. We will be adding them shortly, thank you for your patience.

Publisher
Unpaywall
ISSN
0890-9369
DOI
10.1101/gad.3.11.1745
Publisher site
See Article on Publisher Site

Abstract

Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochrome sequences in Arabidopsis thaliana: structure, evolution, and differential expression of a plant regulatory photoreceptor family Robert A. Sharrock^ and Peter H. Quail Plant Gene Expression Center, Albany, California 94710 USA Phytochrome is a plant regulatory photoreceptor that mediates red light effects on a wide variety of physiological and molecular responses. DNA blot analysis indicates that the Arabidopsis thaliana genome contains four to five phytochrome-related gene sequences. We have isolated and sequenced cDNA clones corresponding to three of these genes and have deduced the amino acid sequence of the full-length polypeptide encoded in each case. One of these proteins ipbyA) shows 65-80% amino acid sequence identity with the major, etiolated-tissue phytochrome apoproteins described previously in other plant species. The other two polypeptides {pbyB and pbyC) are unique in that they have low sequence identity (-50%) with each other, with pbyA, and with all previously described phytochromes. The pbyA, pbyB, and pbyC proteins are of similar molecular mass, have related hydropathic profiles, and contain a conserved chromophore attachment region. However, the sequence comparison data indicate that the three pby genes diverged early in plant evolution, well before the divergence of the two major groups of angiosperms, the monocots and dicots. The steady-state level of the pbyA transcript is high in dark-grown A. tbaliana seedlings and is down-regulated by light. In contrast, the pbyB and pbyC transcripts are present at lower levels and are not strongly light-regulated. These findings indicate that the red/far red light-responsive phytochrome photoreceptor system in A. tbaliana, and perhaps in all higher plants, consists of a family of chromoproteins that are heterogeneous in structure and regulation. [Key Words: Arabidopsis thaliana-, phytochrome; photomorphogenesis; plant gene family; angiosperm evolution; gene expression] Received June 29, 1989; revised version accepted September 4, 1989. Light is an important environmental factor controlling ceptor is one of the primary components of the regula­ plant growth and development. Not only does light pro­ tory system for higher plant photomorphogenesis. vide energy for photosynthesis, but plant growth pat­ The molecular properties of phytochrome have been terns and a large number of plant developmental events, determined most extensively for the abundant chromo- such as formation of leaf primordia, plastid develop­ protein species purified from dark-grown (etiolated) oat ment, and induction of flowering, are also responsive to tissue (Vierstra and Quail 1983). This species is a dimer light cues (Salisbury and Ross 1985). Physiological ex­ of 124-kD subunits (Jones and Quail 1986), each of periments suggest that two major plant regulatory pho­ which contains a covalently attached linear tetrapyrrole toreceptor systems are active in perception of light cues: chromophore (Rudiger and Scheer 1983). The complete one system sensing shorter wavelength blue and UV-A amino acid sequences of the abundant, etiolated-tissue light, and the second sensing predominantly longer phytochrome from oat (Hershey et al. 1985), zucchini wavelength red/far red light (Shropshire and Mohr 1983). (Sharrock et al. 1986), pea (Sato 1988), rice (Kay et al. Up to this time, only the red/far red-responsive photore­ 1989a), and com (Christensen and Quail 1989), have ceptor phytochrome has been isolated (Vierstra and been derived from the corresponding nucleic acid se­ Quail 1986). The quality and quantity of incident red quences. The molecular mechanism of action of phy­ and far red light influence a broad range of responses tochrome is not known. No enzymatic or specific pro­ throughout the plant life cycle and in a wide variety of tein or nucleic acid-binding activity has been assigned to organs and tissues, indicating that the phytochrome re- the chromoprotein. Nonetheless, it is clear that the unique photochromic properties of phytochrome are re­ sponsible for its regulatory function. Phytochrome, both •Present address: Depaitment of Biology, Montana State University, Bozeman, Montana 59717 USA. in plants and as a purified chromoprotein, exists in ei- GENES & DEVELOPMENT 3:1745-1757 © 1989 by Cold Spring Harbor Laboratory Press ISSN 0890-9369/89 $1.00 1745 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shairock and Quail ther of two spectrally distinct conformations: P^ (red (Meyerowitz 1987). In particular, we anticipated that the light-absorbing, X^^ = 666 nm) or Pf^ (far red light-ab­ small genome size of A. thaliana might assist in estab­ sorbing, V „ = 730 nm) (Vierstra and Quail 1983). lishing the minimum number of phytochrome genes These conformations are photointerconvertiblc; irradia­ present in higher plants. Here, we demonstrate that phy­ tion with red light converts Pr to Pf^ and, conversely, ir­ tochrome in A. thaliana is encoded by a small gene radiation with far red light converts Pf^ back to P^. For family of at least three, but more likely four or five, most phytochrome responses, conversion to Pfr induces members. We present the primary sequence of three of the response, and conversion back to P^ cancels the in­ these gene products and their phylogenetic relationship duction (Shropshire and Mohr 1983). In this way, phy­ to each other and to previously described phytochromes. tochrome functions as a reversible regulatory switch for In addition, we present preliminary studies on the ap­ plant photomorphogenic events. parent differential regulation of these genes. In addition to simply being induced by red light, many phytochrome responses show sensitivity to the balance of red and far red light (Smith 1986) and to the intensity Results and duration of illumination (Mancinelli and Rubino Isolation and sequence of phytochrome cDNA clones 1978; Mandoli and Briggs 1981). The complex action from A. thaliana spectra, variability of response and escape times, and differential level of far red reversibility of phytochrome A probe generated by nick-translation of the zucchini responses have frequently been interpreted within the phytochrome cDNA clone pFMDl (Lissemore et al. context of the known molecular properties of the appar­ 1987) was used initially to screen an Arabidopsis ge­ ently homogeneous phytochrome extracted from etio­ nomic library, and a single A. thaliana genomic phy­ lated plant tissue (Kronenberg and Kendrick 1986). tochrome clone was isolated (R. Sharrock, C. Gatz, and Nonetheless, for some time, the possibility has been rec­ P. Quail, unpubl.). Comparison of phytochrome se­ ognized that less abundant forms of phytochrome might quences from distantly related plant species has shown exist and that these might play important or even pre­ previously that the highest conservation of amino acid dominant roles in photoregulation. Indeed, some physio­ and nucleic acid sequence occurs in the amino-terminal logical observations, such as the Zea and Pisum 'para­ half of the receptor, around the chromophore attach­ doxes' (Hillman 1967) and in vivo spectroscopic data ment site (Sharrock et al. 1986). Therefore, a 0.9-kb (Jabben and Holmes 1983), are very difficult to explain single-stranded DNA (ssDNA) probe was prepared from on the basis of one pool of homogeneous phytochrome. the A. thaliana genomic clone covering this region of Tokuhisa and Quail (1983) presented the first direct evi­ the phytochrome-coding sequence (0.9-kb probe; Fig. 1). dence that extracts of fully green oat tissue contain two Blots of total A. thaliana DNA digested with restriction pools of phytochrome: a greatly reduced level of the enzymes show multiple bands of hybridization to this etiolated-tissue form and a second, immunochemically probe (Fig. lA), indicating that the Arabidopsis genome distinct form. Further experiments confirmed these ob­ contains multiple copies of phytochrome-related coding servations (Shimazaki and Pratt 1985; Tokuhisa et al. sequence. 1985) and extended them to a dicot species, pea (Abe et The 0.9-kb probe was used to screen a XgtlO size-frac­ al. 1985). The green-tissue phytochrome from oats is of tionated cDNA library made from poly(A)+ RNA iso­ lower molecular mass, has different spectral properties, lated from 3-week-old green A. thaliana leaves (Craw­ and is more stable in vivo in the presence of light when ford et al. 1988). Several clones were isolated that hy­ compared to the etiolated-tissue form (Tokuhisa et al. bridized to the probe under high-stringency wash 1985). conditions, and the insert from one of these clones, \A2-3, was sequenced. The X.A2-3 insert (Fig. 2A) con­ The biochemical and physiological evidence for a tains the complete amino acid-coding sequence for a second pool of phytochrome led us to screen for plant 124-kD polypeptide (phyA; Fig. 2B), 5'- and 3'-noncoding genomic sequences and cDNA clones that cross-hy­ sequence, and a poly(A) tail. Clones showing less stable bridize under low stringency conditions with nucleic hybridization to the 0.9-kb probe were separated into acid probes derived from the coding sequence of the two classes on the basis of restriction enzyme analysis, abundant, etiolated-tissue phytochrome. This approach and the inserts from representatives of these classes, has been instrumental in the identification of novel XA7-5 and \A1-I, were sequenced (Fig. 2A). The XA7-5 components of receptor and signal transduction systems insert contains the complete amino acid-coding se­ in animals. It has been used successfully to isolate quence for a 129-kD polypeptide (phyB; Fig. 2B), and members of several gene families such as steroid and XAl-I contains the complete coding sequence for a 124- thyroid hormone receptors (Thompson et al. 1987; Gi- guere et al. 1988), protein kinases (Ohno et al. 1988; kD polypeptide (phyC; Fig. 2B). Both of these inserts Schaeffer et al. 1989), and potassium charmels (Butler et contain 5'- and 3'-noncoding sequence and poly(A) tails. al. 1989). We chose to screen for phytochrome-related Restriction enzyme analysis and hybridization of the sequences in Arabidopsis thaliana, a small cruciferous three A. thaliana phytochrome cDNA clones to ge­ plant that exhibits typical photoresponsive character­ nomic DNA blots under high stringency conditions show that the central coding regions of the phyA, phyB, istics and has many features that distinguish it as a and phyC genes correspond to the bands indicated in the model plant system for molecular genetic studies 1746 GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochromes in Arabidopsis quence of the amino-terminal coding region of the phyB Coding regton probe B) Transcript-specific probes cDNA was confirmed by sequencing the same region of 0.9 kb probe AB C an A. thaliana genomic phyB clone (R. Sharrock and P. E H P E H EH EH Quail, unpubl.). kb — 23 Comparison of A. thaliana phytochromes A, B, and C 9.4 It has been reported previously that there are multiple phytochrome genes in oat (Hershey et al. 1985). How­ phyA ever, oat is hexaploid and the genes described encode al­ 4.4 most identical polypeptides (>98% identical). Genomic phyB Southern blot analyses of pea and rice DNA have been interpreted to indicate the presence of only single phy­ tochrome genes (Sato 1988; Kay et al. 1989b) and cDNA 2.3 cloning from zucchini (Lissemore et al. 1987), pea (Sato 2.0 1988), and rice (Kay et al. 1989b| indicated the presence of only a single type of phytochrome transcript in etio­ lated tissue of these plant species. Our results in Arabi­ phyC — dopsis (Figs. 1 and 2) contrast markedly with these pre­ vious reports. To compare the three A. thahana phy­ tochromes, the deduced amino acid sequences of phyA, phyB, and phyC have been aligned in Figure 2B in such a 0.6 way as to minimize the number of gaps introduced. A consensus sequence of residues conserved in all three TAG polypeptides is shown below the alignments. In all pair- X A2-3 iphyA) ^3 1 :^(AAA . .) wise combinations, the phyA, phyB, and phyC polypep­ 0.9 kb probe ATG TAG tides are approximately equally related to one another, X A7-5 [phyB) H I I lk\V\N (AAA 49-52 % identical (Table 1). This level of sequence con­ ATG TGA servation indicates significant structural heterogeneity x^^-^ {phyqE^z :^(AAA... ) and distant evolutionary origins (see Phylogeny of phy­ tochrome genes, below). To better visualize the structural relatedness of the Figure 1. Southern blot analysis of total A. thaliana DNA hy­ phyA, phyB, and phyC polypeptides, the distribution of bridized with a phytochrome-coding region probe (0.9-kb probe) amino acid sequence conservation along each pair of the or with probes specific for the phyA, phyB, and phyC tran­ aligned phytochrome sequences is presented in Figure 3 scripts. Diagrams of the cDNA inserts from the \gtlO phy as a linear plot of percent identity within a 9-amino-acid clones are shown below the blots, and the internal £coRI sites moving window. Short conserved regions are observed and the positions of the probes are indicated. Restriction en­ over almost the entire lengths of phyA, phyB, and phyC. zymes are (E) £coRI; (H) HindUl; (P) Pstl. Similar regions of the three polypeptides are either highly conserved or prone to substitutions, and no large structural domains are conserved in two of the proteins JEcoRI digest on the Southern blot in Figure lA (data not and lost in the third. These data indicate that the overall shown). No cDNA clones corresponding to the two structure of these proteins is conserved. Consistent with highest molecular weight bands in this digest were re­ this interpretation, hydropathy profiles for phyA, phyB, covered in this screen. and phyC are very similar over their entire lengths (Fig. In all three cDNA clones, the initiator methionine 4). Notable deviation from this conserved phytochrome codon for the large phytochrome open reading frame structure occurs at the ends of the phyB polypeptide in (ORF) is not the first AUG present at the 5' end of the the form of amino- and carboxy-terminal extensions. mRNA. The upstream open reading frames (URFs) in The 35-residue phyB amino-terminal extension is un­ each mRNA encode short peptides, 3-12 residues in usual in its high glycine content (37%) and the presence length, before an in-frame translation termination codon of numerous amino acid doublet and triplet repeats (Fig. is reached (Fig. 2A). The large ORF oiphyB contains two 2B), the ftmctional significance of which is not known. methionines in its first 54 amino acids. Initiation of translation at the first methionine gives rise to the 129- kD protein shown in Figure 2B. Initiation at the second Phylogeny of phytochrome genes methionine would produce a 124-kD protein similar to the other phytochrome apoproteins; however, there is The amino acid sequences of the three A. thaliana phy­ currently no reason to invoke preferential initiation at tochromes and the published sequences of phy­ this site. To eliminate the possibility that the first in- tochromes from oat (Hershey et al. 1985), zucchini frame ATG of the phyB sequence was introduced (Sharrock et al. 1986), pea (Sato 1988), rice (Kay et al. through a cDNA cloning artifact, the nucleotide se­ 1989a), and com (Christensen and Quail 1989), have GENES & DEVELOPMENT 1747 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shanock and Quail r^ 1 URF-B 100 A CGTCGTCGTCTGTGTTAGGGAGCACAAATAATAGAGAGGCGTAGCACAAGAGAGAAGGTGGTGATCGAGGCCAAGAT B GTCTCCGATAACTAGTGGATGATGATTCACCCTAAATCCTTCCTTGTCTCAAGGTAATTCTGAGAAATTTCTCAAATTCAAAATCAAA C CAACTTACAAGTTCCTCTCTCAGCTTCTCTCCCACCACTAAGGAGGAACGTTCCAAAGATCCCTTTCTCAGAGAATTCCCAGAAAAATCTTCAACAATTG *B URF-C URF-A 200 A TTAGAATTTAACTATAACAAAAAGCCTCTGACGAGTGTGACTAGTCACAAGATCTGATCATGGCTTrTTGAAACTTCTTCTTCTTCTTTCTTCTCTTTAA B CGGC^rgSTTTCCGGAGTCGGGGGTAGTGGCGGTGGCCGTGGCGGTGGCCGTGGCGGAGAAGAAGAACCGTCGTCAAGTCACACTCCTAATAACCGAAGA C AAACCCTAATGGAGAATCATTCGGATCCTTGAATCCTTTGGTTTGTrTrTCACCTrrATTTCTGAAATTTCATTGCTTTGTGATTCTTCTGCAGATTCGT *A *C 300 A AGGAAAAA^jATGfTCAGGCTCTAGGCCGACTCAGTCCTCTGAGGGCTCAAGGCGATCAAGGCACAGCGCTAGGATCATTGCGCAGACCACTGTAGATGCGA B GGAGGAGAACAAGCTCAATCGTCGGGAACGAAATCTCTCAGACCAAGAAGCAACACTGAATCAATGAGCAAAGCAATTCAACAGTACACCGTCGACGCAA C TTTGAAGAGAAGAAAGA;j^fgrCATCGAACACTTCACGAAGCTGTTCTACTAGATCTAGACAAAACTCTCGAGTTTCTTCACAAGTTCTCGTCGACGCAA A AACTCCATGCTGATTTTGAG GAGTCAGGCAGCTCCTTTGATTACTCAACCTCAGTGCGTGTCACTGGCCCGGTTGTGGAGAATCAGCCACC B GACTCCACGCCGTTTTCGAACAATCCGGCGAATCAGGGAAATCATTCGACTACTCACAATCACTCAAAACGACGACG TACGGTTCCTC C AGCTACACGGAAACTTCGAA GAATCTGAGCGTTTATTTGACTATTCAGCTTCAATAAACTTGAACATGCCAAGTTCTTCCTGTGAGATTCC A AAGGTCTGACAAAGTTACCACGACTTATCTTCATCATATACAGAAGGGAAAGCTGATTCAGCCCTTCGGTTGTTTACTTGCCTTGGATGAGAAGACCTTC B TGTACCTGAGCAACAGATCACAGCTTATCTCTCTCGAATCCAGCGAGGTGGTTACATTCAGCCTTTCGGATGTATGATCGCCGTCGATGAATCCAGTTTC C TTCTTCAGCT GTCTCAACGTACTTACAGAAGATTCAGAGAGGGATGTTGATTCAACCCTTTGGTTGTTTAATCGTTGTTGATGAGAAAAACCTT A AAAGTTATTGCATACAGCGAGAATGCATCTGAGCTGTTGACAATGGCCAGTCATGCAGTTCCTAGTGTTGGCGAACACCCTGTTCTAGGCATTGGGACAG B CGGATCATCGGTTACAGTGAAAACGCCAGAGAAATGTTAGGGATTATGCCTCAATCTGTTCCTACTCTTGAGAAACCTGAGATTCTAGCTATGGGAACTG C AAAGTCATTGCCTTTAGTGAAAACACTCAAGAGATGTTGGGTTTGATTCCACATACAGTACCAAGTATGGAGCAGCGTGAAGCTTTGACTATAGGAACTG A ATATAAGGAGTCTTTTCACTGCTCCTAGTGCGTCTGCATTGCAGAAAGCCCTTGGATTTGGAGATGTCTCTCTTTTGAATCCCATTCTTGTGCACTGCAG B ATGTGAGATCTTTGTTCACTTCTTCGAGCTCGATTCTACTCGAGCGTGCTTTCGTTGCTCGAGAGATTACCTTGTTAAATCCGGTTTGGATCCATTCCAA C ATGTGAAATCATTGTTTCTGTCTCCAGGTTGTTCTGCTTTGGAGAAAGCTGTTGACTTTGGTGAGATTAGTATTTTGAATCCTATCACGCTTCATTGTAG A GACTTCTGCAAAGCCCTTTTATGCGATTATCCACAGGGTTACAGGGAGCATCATCATCGACTTTGAACCCGTGAAGCCTTATGAAGTCCCCATGACAGCT B GAATACTGGTAAACCGTTTTACGCCATTCTTCATAGGATTGATGTTGGTGTTGTTATTGATTTAGAGCCAGCTAGAACTGAAGATCCTGCGCTTTCTATT C GTCTTCAAGTAAGCCTTTTTATGCGATTCTGCATCGGATTGAGGAAGGTCTTGTTATAGATTTGGAGCCTGTGAGTCCTGATGAGGTGCCTGTGACTGCT A GCTGGTGCCTTACAATCATACAAGCTCGCTGCCAAAGCAATCACTAGGCTGCAATCTTTACCCAGCGGGAGTATGGAAAGGCTTTGTGATACAATGGTTC B GCTGGTGCTGTTCAATCGCAGAAACTCGCGGTTCGTGCGATTTCTCAGTTACAGGCTCTTCCTGGTGGAGATATTAAGCTTTTGTGTGACACTGTCGTGG C GCCGGGGCTTTAAGATCGTATAAGCTTGCGGCGAAATCGATTTCGAGGTTGCAGGCATTGCCTAGTGGGAATATGTTGTTGTTGTGTGATGCTTTGGTTA A AAGAGGTTTTTGAACTCACGGGGTATGACAGGGTGATGGCTTATAAGTTTCATGAAGATGATCACGGTGAGGTTGTCTCCGAGGTTACAAAACCTGGGCT B AAAGTGTGAGGGACTTGACTGGTTATGATCGTGTTATGGTTTATAAGTTTCATGAAGATGAGCATGGAGAAGTTGTAGCTGAGAGTAAACGAGACGATTT C AGGAAGTTAGTGAATTAACTGGTTATGATAGGGTGATGGTGTATAAGTTCCATGAGGATGGGCATGGGGAAGTGATTGCTGAATGCTGCCGGGAAGATAT A GGAGCCTTATCTTGGGCTGCATTATCCTGCCACCGACATCCCTCAAGCAGCCCGTTTTCTGTTTATGAAGAACAAGGTCCGGATGATAGTTGATTGCAAT B AGAGCCTTATATTGGACTGCATTATCCTGCTACTGATATTCCTCAAGCGTCAAGGTTCTTGTTTAAGCAGAACCGTGTCCGAATGATAGTAGATTGCAAT C GGAACCTTATCTTGGGTTGCATTACTCCGCTACTGATATACCGCAAGCTTCGAGATTTCTGTTTATGAGAAACAAGGTTAGGATGATTTGTGATTGTTCA A GCAAAACATGCTAGGGTGCTTCAAGATGAAAAGCTTTCCTTTGACCTTACCTTGTGTGGCTCCACCCTTAGAGCACCGCACAGCTGCCATTTGCAGTACA B GCCACACCTGTTCTTGTGGTCCAGGACGATAGGCTAACTCAGTCTATGTGCTTGGTTGGTTCTACTCTTAGGGCTCCTCATGGTTGTCACTCTCAGTATA C GCGGTTCCGGTTAAAGTCGTTCAAGATAAGAGTCTCTCACAGCCAATAAGTCTTTCTGGATCTACTTTGAGAGCTCCTCATGGTTGTCACGCACAGTATA A TGGCCAACATGGATTCAATTGCATCTCTGGTTATGGCGGTTGTAGTTAACGAGGAAGATGGAGAAGGGGATGCTCCTGATGCTACTACACAGCCTCAAAA B TGGCTAACATGGGATCTATTGCGTCTTTAGCAATGGCGGTTATAATCAATGGAAATGAAGATGATGGGAGCAATGTAGCTAGTGGA AGAAG C TGAGTAATATGGGATCAGTGGCGTCTCTTGTCATGTCTGTAACTATCAATGGTAGTGATAGTGATGAGATGAACAGAGATTTA CAGAC A GAGAAAGAGACTATGGGGTTTAGTGGTTTGTCACAATACGACTCCGAGGTTTGTTCCATTTCCTCTCAGGTATGCCTGTGAGTTTCTAGCTCAAGTGTTT B CTCGATGAGGCTTTGGGGTTTGGTTGTTTGCCATCACACTTCTTCTCGCTGCATACCGTTTCCGCTAAGGTATGCTTGTGAGTTTTTGATGCAGGCTTTC C TGGCAGACACTTATGGGGCTTGGTGGTTTGTCATCACGCAAGTCCTAGATTTGTTCCGTTTCCATTACGATATGCTTGTGAATTCTTGACTCAAGTATTT A GCCATACACGTCAATAAGGAGGTGGAACTCGATAACCAGATGGTGGAGAAGAACATTTTGCGCACGCAGACACTCTTGTGCGATATGCTGATGCGTGATG B GGTTTACAGTTAAACATGGAATTGCAGTTAGCTTTGCAAATGTCAGAGAAACGCGTTTTGAGAACGCAGACACTGTTATGTGATATGCTTCTGCGTGACT C GGCGTGCAGATCAACAAAGAAGCGGAATCAGCTGTTCTGTTGAAAGAGAAGCGTATTTTGCAAACTCAGAGTGTGCTATGTGACATGCTTTTCCGCAATG A CTCCACTGGGTATTGTGTCGCAAAGCCCCAACATAATGGACCTTGTGAAATGTGATGGAGCAGCTCTCTTGTATAAAGACAAGATATGGAAACTGGGAAC B CGCCTGCTGGAATTGTTACACAGAGTCCCAGTATCATGGACTTAGTGAAATGTGACGGTGCAGCATTTCTTTACCACGGGAAGTATTACCCGTTGGGTGT C CACCAATAGGTATAGTCACTCAATCACCAAATATAATGGATCTTGTTAAATGTGATGGAGCAGCATTATATTACAGAGACAACCTCTGGTCTCTAGGAGT A AACTCCAAGTGAGTTCCACCTGCAGGAGATAGCTTCATGGTTGTGTGAATACCACATGGATTCAACGGGTTTGAGCACTGATAGTTTGCATGACGCCGGG B TGCTCCTAGTGAAGTTCAGATAAAAGATGTTGTGGAGTGGTTGCTTGCGAATCATGCGGATTCAACCGGATTAAGCACTGATAGTTTAGGCGATGCGGGG C TACTCCCACAGAGACACAAATTAGAGATCTAATTGACTGGGTTCTCAAAAGTCATGGAGGAAACACTGGCTTTACCACTGAAAGTCTAATGGAGTCTGGC A TTTCCTAGGGCTCTATCTCTCGGGGATTCGGTATGTGGGATGGCAGCTGTGAGGATATCATCGAAAGACATGATTTTCTGGTTCCGTTCTCATACCGCTG B TATCCCGGTGCAGCTGCGTTAGGGGATGCTGTGTGCGGTATGGCAGTTGCATATATCACAAAAAGAGACTTTCTTTTTTGGTTTCGATCTCACACTGCGA C TATCCGGATGCTTCTGTTCTTGGGGAGTCAATATGTGGAATGGCTGCCGTATATATTTCCGAAAAAGATTTCCTTTTCTGGTTCCGGTCTAGCACTGCAA A GTGAAGTGAGATGGGGAGGTGCGAAGCATGATCCAGATGATAGGGATGATGCAAGGAGAATGCACCCAAGGTCATCGTTCAAGGCTTTCCTTGAAGTGGT B AAGAAATCAAATGGGGAGGCGCTAAGCATCATCCGGAGGATAAAGATGATGGGCAACGAATGCATCCTCGTTCGTCCTTTCAGGCTTTTCTTGAAGTTGT C AACA6ATCAAGTGGGGTGGTGCAAGACACGATCCTAATGACAGA...GATGGTAAGAGAATGCATCCTAGATCCTCATTCAAGGCTTTTATGGAAATAGT A CAAGACAAGGAGTTTACCTTGGAAGGACTATGAGATGGATGCCATACACTCCTTGCAACTTATTTTGAGGAATGCTTTCAAGGATAGTGAAACTACT. . . B TAAGAGCCGGAGTCAGCCATGGGAAACTGCGGAAATGGATGCGATTCACTCGCTCCAGCTTATTCTGAGAGACTCTTTTAAAGAATCTGAGGCGGCTATG C CAGGTGGAAAAGTGTGCCCTGGGATGACATGGAAATGGATGCAATTAATTCTCTGCAGCTAATAATAAAAGGCTCATTGCAAGAGGAGCATTCA Figure 2. (See p. 1750 for legend. ] 1748 GENES &, DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochiomes in Arabidopsis A GATGTGAATACAAAGGTCATTTACTCGAAGCTAAATGATCTCAAAATTGATGGTATACAAGAACTAGAAGCTGTGACCAGTGAGATGGTTCGTT B AACTCTAAAGTTGTGGATGGTGTGGTTCAGCCATGTAGGGATATGGCGGGGGAACAGGGGATTGATGAGTTAGGTGCAGTTGCAAGAGAGATGGTTAGGC C AAGACTGTTGTGGATGTCCCACTTGTGGATAATAGGGTTCAGAAGGTAGATGAATTGTGTGTTATCGTGAATGAAATGGTGCGGT A TAATTGAGACTGCTACGGTGCCAATATTGGCGGTTGATTCTGATGGACTGGTTAATGGTTGGAACACGAAAATTGCTGAGCTGACTGGTCTTTCGGTTGA B TCATTGAGACTGCAACTGTTCCTATATTCGCTGTGGATGCCGGAGGCTGCATCAATGGATGGAACGCTAAGATTGCAGAGTTGACAGGTCTCTCAGTTGA C TGATTGATACAGCAGCTGTTCCCATCTTTGCGGTTGATGCCTCTGGTGTTATAAATGGTTGGAATTCTAAAGCGGCTGAGGTAACAGGATTGGCAGTTGA A TGAAGCAATCGGGAAGCATTTCCTCACA. . . CTTGTTGAAGATTCTTCAGTGGAAATCGTTAAAAGGATGCTAGAGAACGCATTAGAAGGAACTGAGGAG B AGAAGCTATGGGGAAGTCTCTGGTTTCTGATTTAATATACAAAGAGAATGAAGCAACTGTCAATAAGCTTCTTTCTCGTGCTTTGAGAGGGGACGAGGAA C ACAAGCAATAGGCAAACCT...GTATCAGATCTCGTTGAGGACGATTCTGTAGAAACCGTGAAGAACATGTTAGCCTTGGCTCTCGAAGGTAGTGAAGAA A CAGAATGTCCAGTTTGAGATCAAGACACATCTGTCCAGGGCTGATGCTGGGCCAATAAGTTTAGTTGTAAATGCATGCGCAAGTAGAGATCTCCATGAAA B AAGAATGTGGAGGTTAAGCTGAAAACTTTCAGCCCCGAACTACAAGGGAAAGCAGTTTTTGTGGTTGTGAATGCTTGTTCCAGCAAGGACTACTTGAACA C CGTGGTGCTGAGATCAGGATCAGAGCATTTGGTCCTAAAAGGAAAAGCAGTCCGGTTGAGTTAGTTGTCAACACTTGTTGTAGCAGAGATATGACGAATA A ACGTGGTTGGGGTGTGTTTTGTAGCCCATGATCTTACTGGCCAGAAGACTGTGATGGACAAGTTTACGCGGATTGAAGGTGATTACAAGGCAATCATCCA B ACATTGTCGGCGTTTGTTTTGTTGGACAAGACGTTACTAGTCAGAAAATCGTAATGGATAAGTTCATCAACATACAAGGAGATTACAAGGCTATTGTACA C ATGTTCTTGGTGTATGCTTCATTGGACAAGATGTTACAGGCCAGAAAACGCTTACTGAAAACTATAGCCGCGTGAAAGGAGATTATGCCCGAATCATGTG A AAATCCAAACCCGCTGATCCCGCCAATATTTGGTACCGATGAGTTTGGATGGTGCACAGAGTGGAATCCAGCAATGTCAAAGTTAACCGGTTTGAAGCGA B TAGCCCAAACCCTCTAATCCCGCCAATTTTTGCTGCTGACGAGAACACGTGCTGCCTGGAATGGAACATGGCGATGGAAAAGCTTACGGGTTGGTCTCGC C GAGCCCTTCCACACTCATTCCACCAATTTTTATAACCAATGAAAATGGGGTATGCTCAGAGTGGAACAACGCAATGCAGAAGCTCTCTGGGATAAAGAGA A GAGGAAGTGATTGACAAAATGCTCTTAGGAGAAGTATTTGGGACGCAGAAGTCATGTTGTCGTCTAAAGAATCAAGAAGCCTTTGTAAACCTTGGGATTG B AGTGAAGTGATTGGGAAAATGATTGTCGGGGAAGTGTTTGGG AGCTGTTGCATGCTAAAGGGTCCTGATGCTTTAACCAAGTTCATGATTG C GAAGAAGTTGTCAATAAAATTCTTCTCGGGGAGGTTTTTACCACAGATGATTATGGTTGCTGCCTTAAAGACCATGACACTTTAACGAAGCTGAGAATAG A TGCTGAACAATGCTGTGACCAGTCAA...GATCCAGATAAAGTATCGTTTGCTTTCTTTACAAGAGGTGGCAAGTATGTGGAGTGTCTGTTGTGTGTGAG B TATTGCATAATGCGATTGGTGGCCAA...GATACGGATAAGTTCCCTTTCCCATTCTTTGACCGCAATGGGAAGTTTGTTCAGGCTCTATTGACTGCAAA C GTTTCAATGCTGTGATTTCTGGCCAAAAGAACATAGAGAAGCTTTTATTTGGCTTTTACCATCGTGATGGTAGCTTCATCGAGGCATTGCTTTCTGCAAA A TAAGAAACTGGACAGGAAAGGTGTAGTGACAGGTGTCTTCTGTTTCCTGCAACTTGCCAGCCATGAGCTGCAGCAAGCGCTCCATGTTCAACGTTTAGCT B CAAGCGGGTTAGCCTCGAGGGAAAGGTTATTGGGGCTTTCTGTTTCTTGCAAATCCCGAGCCCTGAGCTGCAGCAAGCTTTAGCAGTCCAACGGAGGCAG C CAAAAGGACTGATATTGAGGGAAAGGTTACCGGGGTTTTATGCTTTTTGCAAGTACCTAGTCCAGAACTCCAATATGCTCTACAGGTTCAGCAAATATCA A GAGCGAACCGCAGTGAAGAGACTAAAGGCTCTAGCATACATAAAAAGACAGATCAGGAATCCGCTATCTGGGATCATGTTTACAAGGAAAATGATAGAGG B GACACAGAGTGTTTCACGAAGGCAAAAGAGTTGGCTTATATTTGTCAGGTGATAAAGAATCCTTTGAGCGGTATGCGTTTCGCAAACTCATTGTTGGAGG C GAGCATGCAATTGCCTGTGCCCTCAACAAATTGGCATATCTCCGCCATGAAGTGAAGGACCCCGAAAAGGCAATATCCTTCCTTCAAGATTTGCTCCATT A GTACTGAATTAGGACCAGAGCAAAGACGGATTTTGCAAACTAGCGCGTTATGTCAGAAGCAACTAAGCAAGATCCTCGATGATTCGGATCTTGAAAGCAT B CCACAGACTTGAACGAGGACCAGAAGCAGTTACTTGAAACAAGTGTTTCTTGCGAGAAACAGATCTCAAGGATCGTCGGGGACATGGATCTTGAAAGCAT C CATCTGGATTAAGTGAAGACCAAAAGCGGCTCCTGAGGACAAGCGTTTTATGCAGGGAGCAGTTAGCCAAAGTCATAAGCGACTCAGACATAGAGGGAAT A CATTGAAGGATGCTTGGATTTGGAAATGAAAGAATTCACCTTAAATGAAGTGTTGACTGCTTCCACAAGTCAAGTAATGATGAAGAGTAACGGAAAGAGT B TGAAGACGGTTCATTTGTGCTAAAGAGGGAAGAGTTTTTCCTTGGAAGTGTCATAAACGCGATTGTAAGTCAAGCGATGTTCTTATTAAGGGACAGAGGT C CGAAGAAGGCTATGTGGAACTGGATTGCAGCGAATTCGGCCTGCAGGAATCCCTGGAAGCAGTTGTAAAACAAGTGATGGAGCTGAGCATAGAACGTAAA A GTTCGGATAACAAATGAGACCGGAGAAGAAGTAATGTCTGACACTTTGTATGGAGACAGTATTAGGCTTCAACAAGTCTTGGCAGATTTCATGCTGATGG B CTTCAGCTGATCCGTGACATTCCCGAAGAGATCAAATCAATAGAGGTTTTTGGAGACCAGATAAGGATTCAACAGCTCCTGGCTGAGTTTCTGCTGAGTA C GTACAAATCAGCTGCGATTATCCTCAAGAAGTTTCATCAATGAGATTGTATGGAGACAACTTAAGGCTTCAGCAAATCCTTTCAGAGACACTATTAAGCA A CTGTAAACTTTACACCATCCGGAGGTCAGCTAACTGTTTCAGCTTCCCTG AGGAAGGATCAGCTCGGGCGTTCTGTGCATCTTGCTAATCTAGA B TAATCCGGTATGCACCATCTCAAGAGTGGGTGGAGATCCATTTAAGCCAACTTTCAAAGCAAATGGCTGATGGA TTCGCCGCCATCCGCACAGA C GCATACGCTTCACGCCTGCATTGAGAGGATTGTGTGTCTCATTCAAGGTAATTGCACGGATAGAAGCTATAGGAAAAAGAATGAAAAGAGTCGAACTTGA A GATCAGGTTAACGCATACCGGAGCTGGGATACCTGAGTTTTTACTAAACCAAATGTTTGGGACT . . . GAGGAAGATGTGTCAGAAGAAGGATTGAGCTTA B ATTCAGAATGGCGTGTCCAGGTGAAGGTCTGCCTCCAGAGCTAGTCCGAGACATGTTCCATAGCAGCAGGTGG...ACAAGCCCTGAAGGTTTAGGTCTA C GTTCAGGATAATACACCCGGCACCAGGACTGCCTGAGGATCTGGTAAGAGAGATGTTTCAGCCTTTGAGAAAGGGAACATCAAGGGAAGGTTTGGGATTA A ATGGTTAGCCGGAAACTGGTGAAGCTGATGAAT...GGAGATGTTCAGTACTTGAGACAAGCTGGGAAATCAAGTTTCATTATCACTGCGGAACTCGCTG B AGCGTATGTCGAAAGATTTTAAAGCTAATGAAC...GGTGAGGTTCAATACATCCGAGAATCAGAACGGTCCTATTTCCTCATCATTCTGGAACTCCCTG C CACATTACCCAGAAGCTGGTGAAACTCATGGAGAGAGGAACATTGAGATACCTCAGAGAGTCTGAAATGTCAGCCTTTGTGATCCTCACAGAATTTCCCT *C *A *B 3700 A CAGC:AAACAA(^AGtrCCCCAAAAGAAAAGGGGTCTGGCTTGATATAAAATAGTCACTGGTTGTTCTTTGCTTGTAACTTTCCTTATCGCTTTT6TTTTCG B TACCTCGAAAGCGACCATTGTCAACTGCTAGTGGAAGTGGTGACATGATGCTGATGATGCCATA'ifrAGtrCACACTTCAGTTGGTATGAGAGTTTGTATCA C fTG^TTGAAGCTGAAGACCTGTCTACAAGATTTACATTTTATTGAATAAGTGTGGTGTTTTTGAAAGTCTTCATTTTTTTTTCTCACATATATAAATGTA PRIMER C PRIMER A 3800 A TTTTraaATTTrftGTAArGATGannTaTrraTrraTTTftraTrTTrTP;TTF;ARrTrTTTTrTGAAGrTGTAAATATGGATGCATATCTAATCTC(AAA..) B TTGTATGAGTGTTTGTGTGTCTAACGACGTCGGAGGAGGATAGAAAGTTTTTTTTTTGTTTCCGGTGAGATTAGTAGAGAAGAGGGAGATTATTTGCGTT C TGTTTAGTTACCGTAACTTAATTACATATATATATATAGGAAAGTTAAATTTG(AAA..) PRIMER B B CAGCTCAGCTCGCCGGAAAAAAAACGTAACAGTAGTTGTAGAGAATTTCAAGACTTTTGTTTGTGCTGTGTAAATTGACAACTCCGAGAGAAACAAAACA B ATGAGAT(AAA..) Figure 2. {See p. 1750 for legend.) GENES & DEVELOPMENT 1749 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shanock and Quail 1 50 100 A MSGSRPTQSSEGSRRSRHSARIIAQTTVDAKLHADFE...ESGSSFDYSTSVRVTGPWENQPPR B MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTT....YGSSV C MSSNTSRSCSTRSRQNSRVSSQVLVDAKLHGNFE...ESERLFDYSASINLNMPSSSCEIPS Cons S Q VDA LH FE ES FDYS S 15 0 200 A SDKVTTTYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENASELLTMASHAVPSVGEHPVLGIGTDIRSLFTAPSASALQKALGFGDVSLLNPILVHCRT B PEQQITAYLSRIQRGGYIQPFGCMIAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAMGTDVRSLFTSSSSILLERAFVAREITLLNPVWIHSKN C SA..VSTYLQKIQRGMLIQPFGCLIWDEKNLKVIAFSENTQEMLGLIPHTVPSMEQREALTIGTDVKSLFLSPGCSALEKAVDFGEISILNPITLHCRS Con s YL IQ G IQPFGC DE I SEN E L VP L GTD SLF L A LNP H 25 0 300 A SAKPFYAIIHRVTGSIIIDFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMVQEVFELTGYDRVMAYKFHEDDHGEWSEVTKPGLE B TGKPFYAILHRIDVGWIDLEPARTEDPALSIAGAVQSQKLAVRAISQLQALPGGDIKLLCDTWESVRDLTGYDRVMVYKFHEDEHGEWAESKRDDLE C SSKPFYAILHRIEEGLVIDLEPVSPDEVPVTAAGALRSYKLAAKSISRLQALPSGNMLLLCDALVKEVSELTGYDRVMVYKFHEDGHGEVIAECCREDME Con s KPFYAI HR IDLEP AGA S KLA I LQ LP G LCD V V LTGYDRVM YKFHED HGEV E E 35 0 * 400 A PYLGLHYPATDIPQAARFLFMKNKVRMIVDCNAKHARVLQDEKLSFDLTLCGSTLRAPHSCHLQY^4ANMDSIASLVMAVVVNEEDGEGDAPDATTQPQKR B PYIGLHYPATDIPQASRFLFKQNRVRMIVDCNATPVLWQDDRLTQSMCLVGSTLRAPHGCHSQYMANMGSIASLAMAVIINGNEDDGSNVASG...RSS C PYLGLHYSATDIPQASRFLFMRNKVRMICDCSAVPVKWQDKSLSQPISLSGSTLRAPHGCHAQYMSNMGSVASLVMSVTINGSDSDEMNRDL....QTG Con s PY GLHY ATDIPQA RFLF N VRMI DC A V QD L L GSTLFIAPH CH QYM NM S ASL M V N 450 500 A KRLWGLWCHNTTPRFVPFPLRYACEFLAQVFAIHVNKEVELDNQMVEKNILRTQTLLCDMLMRDAPLGIVSQSPNIMDLVKCDGAALLYKDKIWKLGTT B MRLWGLWCHHTSSRCIPFPLRYACEFLMQAFGLQLNMELQLALQMSEKRVLRTQTLLCDMLLRDSPAGIVTQSPSIMDLVKCDGAAFLYHGKYYPLGVA C RHLWGLWCHHASPRFVPFPLRYACEFLTQVFGVQINKEAESAVLLKEKRILQTQSVLCDMLFRNAPIGIVTQSPNIMDLVKCDGAALYYRDNLWSLGVT Cons LWGLWCH R PFPLRYACEFL Q F N E EK L TQ LCDML R P GIV QSP IMDLVKCDGAA Y LG 55 0 600 A PSEFHLQEIASWLCEYHMDSTGLSTDSLHDAGFPRALSLGDSVCGMAAVRISSKDMIFWFRSHTAGEVRWGGAKHDPDDRDDARRMHPRSSFKAFLEWK B PSEVQIKDWEWLLANHADSTGLSTDSLGDAGYPGAAALGDAVCGMAVAYITKRDFLFWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFQAFLEWK C PTETQIRDLIDWVLKSHGGNTGFTTESLMESGYPDASVLGESICGMAAVYISEKDFLFWFRSSTAKQIKWGGARHDPNDR.DGKRMHPRSSFKAFMEIVR Con s P E W H TG T SL G P A LG CGMA I D FWFRS TA WGGA H P D D RMHPRSSF AF E V 65 0 VOO A TRSLPWKDYEMDAIHSLQLILRNAFKDSETT...DVNTKVIYSKLNDLKIDGIQELEAVTSEMVRLIETATVPILAVDSDGLVNGWNTKIAELTGLSVDE B SRSQPWETAEMDAIHSLQLILRDSFKESEAAMNSKWDGWQPCRDMAGEQGIDELGAVAREMVRLIETATVPIFAVDAGGCINGWNAKIAELTGLSVEE C WKSVPWDDMEMDAINSLQLIIKGSLQEEHS KTWDVPLVDNRVQKVDELCVIVNEMVRLIDTAAVPIFAVDASGVINGWNSKAAEVTGLAVEQ Con s S PW EMDAI SLQLI V EL EMVRLI TA VP I AVD G NGWN K AE TGL V 75 0 800 A AIGKHFLT.LVEDSSVEIVKRMLENALEGTEEQNVQFEIKTHLSRADAGPISLWNACASRDLHENWGVCFVAHDLTGQKTVMDKFTRIEGDYKAIIQN B AMGKSLVSDLIYKENEATVNKLLSRALRGDEEKNVEVKLKTFSPELQGKAVFVVVNACSSKDYLNNIVGVCFVGQDVTSQKIVMDKFINIQGDY?CAIVHS C AIGKP.VSDLVEDDSVETVKNMLALALEGSEERGAEIRIRAFGPKRKSSPVELWNTCCSRDMTNNVLGVCFIGQDVTGQKTLTENYSRVKGDYARIMWS Con s A GK L V L AL G EE WN C S D N GVCF D T QK GDY I 85 0 900 A PNPLIPPIFGTDEFGWCTEWNPAMSKLTGLKREEVIDKMLLGEVFGTQKSCCRLKNQEAFVNLGIVLNNAVTSQ.DPDKVSFAFFTRGGKYVECLLCVSK B PNPLIPPIFAADENTCCLEWNMAMEKLTGWSRSEVIGKMIVGEVFG...SCCMLKGPDALTKFMIVLHNAIGGQ.DTDKFPFPFFDRNGKFVQALLTANK C PSTLIPPIFITNENGVCSEWNNAMQKLSGIKREEWNKILLGEVFTTDDYGCCLKDHDTLTKLRIGFNAVISGQKNIEKLLFGFYHRDGSFIEALLSANK Con s P LIPPIF E C EWN AM KL G R EV K GEVF CLK I QKFFRG LLK 95 0 1000 A KLDRKGWTGVFCFLQLASHELQQALHVQRLAERTAVKRLKALAYIKRQIRNPLSGIMFTRKMIEGTELGPEQRRILQTSALCQKQLSKILDDSDLESII B RVSLEGKVIGAFCFLQIPSPELQQALAVQRRQDTECFTKAKELAYICQVIKNPLSGMRFANSLLEATDLNEDQKQLLETSVSCEKQISRIVGDMDLESIE C RTDIEGKVTGVLCFLQVPSPELQYALQVQQISEHAIACALNKLAYLRHEVKDPEKAISFLQDLLHSSGLSEDQKRLLRTSVLCREQLAKVISDSDIEGIE Con s G V G CFLQ S ELQ AL VQ LAY P F LQLTSCQ DDEI 105 0 1100 A EGCLDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVMSDTLYGDSIRLQQVLADFMLMAVNFTPSGGQLTVSASL..RKDQLGRSVHLANLEI B DGSFVLKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRYAPSQEWVEIHLSQLSKQMADG..FAAIRTEF C EGYVELDCSEFGLQESLEAWKQVMELSIERKVQISCDYPQEVSSMRLYGDNLRLQQILSETLLSSIRFTPALRGLCVSFKVIARIEAIGKRMKRVELEF Con s GLEFLAQ M ESGDRQQLL P G E 1150 1187 A RLTHTGAGIPEFLLNQMFGT.EEDVSEEGLSLMVSRKLVKLMN.GDVQYLRQAGKSSFIITAELAAANK B RMACPGEGLPPELVRDMFHSSRW.TSPEGLGLSVCRKILKLMN.GEVQYIRESERSYFLIILELPVPRKRPLSTASGSGDMMLMMPy C RIIHPAPGLPEDLVREMFQPLRKGTSREGLGLHITQKLVKLMERGTLRYLRESEMSAFVILTEFPLI Cons R G P L MF S EGL L K KLM G Y R S F I E Figure 2. [A] Nucleotide sequences of the cDNA inserts from \A2-3(phyA), \A7-5{phyB], and XAl-l(phyC). The coding regions of the three sequences have been aligned so that they correspond to the peptide sequence alignment in B. Because the initiator ATG codons for the three sequences do not line up in this alignment, the first nucleotide of the phyB cDNA sequence has arbitrarily been given position 1. The initiator ATG codons for the phytochrome ORFs are boxed and marked above the alignment M^ith an asterisk. Termi­ nation codons are also boxed and marked. Sequences at the 3 ' ends of the cDNAs, to which antisense synthetic oligonucleotides were armealed and elongated to make transcript-specific hybridization probes, are underlined and labeled. Primer A was elongated to a Pstl site at position 3598, primer B to an Rsal site at position 3601, and primer C to a PflMl site at position 3512 (see Materials and methods). URFs at the 5' ends of the cDNAs are underlined and labeled. [B] Polypeptide sequences of phyA, phyB, and phyC were deduced from the nucleotide sequences in A. The polypeptides have been aligned in such a way as to maximize homology. Residues conserved in all three polypeptides are shown below the alignment. The cysteine residue (361) that corresponds to the chromophore attachment site identified in purified oat phytochrome is indicated by an asterisk. 1750 GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochiotnes in Arabidopsis Table 1. Percent amino acid sequence identity among idues in the alignment, including gaps and amino- and phytochromes from various plant species and A. thaliana carboxy-terminal extensions. These values are displayed phyA, B, and C in the lower left of Table 1, below the diagonal, and are an index of the degree of structural relatedness of the phyA phytochromes paired polypeptides. Second, the number of identical monocot dicot amin o acids has been divided by the numbe r of residues oat rice :om zucchini pea ;: hyj 4 phyB phyC in the shorter of the two sequences, ignoring gaps and extension s (Table 1, upper right above the diagonal). Oat 89 88 -64- 64 I 48 Values calculated in this way provide an index of the Rice 89 88 164 65 64 49 exten t of evolutionary relatedness of the paired se­ Com 88 88 quences (DooUttle 1981; Feng et al. 1985). These two 'L_64 65 64 48 method s of calculation yield only minor differences in "6 3 ~ -64- Zucchini '63^ |78 52 79 51 th e values obtained, and these differences are not con­ Pea 64 64 78 — 79 51 52 sidered further here. Th e values determined (Table 1) in­ dicate that all previously described phytochrome poly­ phyA , 63 63j 79 — 79 52 52 peptides are significantly more related to th e A. thaliana phyB 46 49 48 49 51 phyA protein than to phyB and phyC. These previously phyC 48 48 48 51 51 characterized sequences correspond to the abundant 52 49 etiolated-tissue phytochromes in these species and are For each pair of aligned sequences, the number of identical res­ very likely functional homologs of one another. We pro­ idues was divided either by the total number of positions in the pose that the designation phyA be extended to these se­ alignment, including gaps and extensions, (below the diagonal) quences . Withi n this group, the three monoco t phyA se­ or by the number of amino acids in the shorter of the two se­ quences are highly related to each other (88-89% iden­ quences (above the diagonal) and expressed as a percent. Values tical), the three dicot phyA sequences are less related to derived for comparisons within monocot or dicot phyA se­ quences are boxed; values for comparisons between monocot each other (78-79% identity), and comparisons across and dicot sequences are enclosed by dashed lines. References monocot/dico t lines show 63-65 % identity. These re­ for previously published phytochrome sequences are oat (Her- sult s are similar, in general, to results obtained for phy- shey et al. 1985), rice (Kay et al. 1989a), corn (Christensen and logenetic comparison of glyceraldehyde-3-phosphate de­ Quail 1989), zucchini (Sharrock et al. 1986), and pea (Sato 1988). hydrogenase and chalcone synthase sequences from various angiosperm plant species (Martin et al. 1989). In contrast, the Arabidopsis phyB and phyC sequences are uniqu e in that they are equivalently and highly diver­ been aligned, and the percent identical residues in each gent from each other and from all of the phyA phy­ pairwise combination has been calculated in two ways. tochrome s (Table 1). First, the number of identical amino acids has been di­ Th e data in Table 1 can be interpreted most readily as vided by the total number of positions occupied by res­ AMINO ACID RESIDUES 400 600 800 COOH Figure 3. Local level of amino acid sequence identity for the three pairwise alignments of phyA, phyB, and phyC. The number of identical residues within a window of 9 amino acids is expressed as percent identity and plotted at the middle position of the window. Gaps in the alignment in Fig. 2B are counted as mismatches. Shaded areas correspond to regions of >50% identity. A schematic representation of the longest polypeptide, phyB, is shown below the plots, indicating the position of the chromophore attachment site. GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shaiiock and Quail HYDROPHOBIC HYDROPHILIC AMINO AaO RESIDUES Figure 4. Hydropathy profiles of phyA, phyB, and phyC. Hydropathy analysis was performed according to Kyte and Doolittle (1982), using a window of 9 amino acids. The profiles have been aligned in the same way as the sequences in Fig. 2B, with gaps introduced at the same position. defining a phylogenetic tree containing a tripartite clones (see Materials and methods, Figs. 1 and 2A) to branching of the three major phytochrome types (A, B, determine the patterns of expression of the three phy­ and C) from a precursor gene followed by subsequent di­ tochrome genes. The transcript-specific probes detect vergence of the phyA genes (Fig. 5). Parsimony analysis unique bands on total A. thaliana DNA Southern blots using the PHYLIP programs of Felsenstein (1985) of the (Fig. IB). When hybridized to Northern blots of total nucleotide sequences for the eight phytochrome genes RNA isolated from 5-day-old A. thahana seedlings yields an unrooted phylogenetic tree, consistent with grown imder various light conditions, all three probes that shown in Figure 5 (R. Sharrock and P. Quail, un- detect RNAs 4.0-4.4 kb in length (Fig. 6), consistent publ.). The tree indicates that the trifurcation of the with the sizes of the cDNAs that were isolated (3.6-3.8 phytochrome gene family into types A, B, and C is an kb). ancient evolutionary event. If the branch point for diver­ The level of phyA mRNA is high in dark-grown tissue, gence of the monocot and dicot phyA sequences in is not strongly affected by a pulse of red light, but is Figure 5 corresponds to the divergence of the monocots markedly reduced within a few hours after transfer to and dicots during angiosperm evolution, 100-300 mil­ white light (Fig. 6). In addition, the phyA probe hy­ lion years ago (Lidgard and Crane 1988; Martin et al. bridizes to more than one RNA transcript. The lower 1989), the gene duplication events that gave rise to molecular weight (4.0 kb) phyA transcript appears to be phyA, phyB, and phyC occurred before that, much ear­ strongly down-regulated by white light, whereas the lier in the evolution of vascular plants. higher molecular weight (4.4 kb) transcript is clearly vis­ ible only in the white light-irradiated sample (Fig. 6). A situation similar to this has been described for the gene Expression of the phyA, phyB, and phyC mRNAs encoding the phyA homolog in pea, where the multiple We used transcript-specific ssDNA hybridization probes transcripts were shown to be the result of transcription derived from sequences at the 3' ends of the cDNA initiation at multiple start sites within a complex pro- • Oat phy3 • Rice phy18 • Corn phyA1 • Zucchini phy • Pea phy Precursor _ • Arabidopsis phyA Phytochrome Figure 5. Deduced phylogeny of phytochrome poly­ • Arabidopsis phyB peptides. Percent amino acid sequence identity be­ tween each pairwise combination of phytochromes • Arabidopsis phyC (Table 1, values above the diagonal) was used to I I I I I group related sequences and as a measure of phyloge­ 50 60 70 80 90 100 netic distance in constructing the tree. % Amino Acid Sequence Identity GENES & DEVELOPMENT 1752 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochromes in Arabidopsis moter (Sato 1988). A complex promoter structure analo­ White Light gous to the pea phyA promoter is located upstream of 1 3 5 CONT. D R the A. thaliana phyA gene (R. Sharrock and P. Quail, FR kb unpubl.). The A. thaliana phyB and phyC mRNAs are .4.4 less abundant than the phyA mRNA in dark-grown ^ ^ -^ phyA 4.0 ••« • tissue (5-10%) and are not strongly regulated by the light conditions tested, although the phyB transcript level shows a small transient increase following transfer to white light (Fig. 6). phyB — 4.0 Discussion We used the technique of low stringency hybridization to identify and isolate A. thaliana cDNA clones that are 4.0 phyC related to the red light-responsive photoreceptor phy- tochrome and presented the sequences of three such cDNAs and their derived polypeptides. These sequences Figure 6. Blot hybridization analysis of the phy mRNAs include the A. thaliana homolog of the previously char­ present in total RNA from A. thaliana seedlings. RNA was iso­ acterized abundant etiolated-tissue phytochrome (phyA) lated from seedlings that were grown for 5 days completely in and identify two new classes of phytochrome apopro­ the dark (D), given a pulse of red (R) or red followed by far red teins (phyB and phyC). In addition to these three pro­ light (R/FR) 3 hr prior to harvest, transferred to white light for teins, there is evidence from DNA blot analysis for the 1, 3, or 5 hr prior to harvest, or grown for 5 days in continuous white light (CONT). Blots were probed with the ssDNA tran­ presence of one or two additional related sequences in script-specific probes for the phyA, phyB, and phyC mRNAs the A. thaliana genome. We propose that A. thaliana (Fig. 1). Transcript sizes were estimated from mobility relative contains a family of at least three, and potentially five, to RNA molecular weight standards. phytochrome genes whose products are diverse, red light-responsive regulatory photoreceptors. This pro­ posal has implications for the mechanism of regulatory light perception in all plants. Hormone and growth factor receptors in animal systems are frequently terization of the chromophore-containing forms of these members of gene families or superfamilies that encode proteins. The levels of phyB and phyC mRNA detected numerous related receptor structures (Evans 1988; in etiolated A. thaliana seedlings indicate that the phyB Yarden and Ullrich 1988). Structural homology within and phyC proteins are likely to be less abundant than these families reflects general similarity in their mode of phyA phytochrome in this tissue. Previously, there have action, such as conserved DNA-binding or protein ki­ been several reports of low-abundance, green-tissue nase domains, whereas differential activities of indi­ forms of phytochrome in oat and pea that are immimo- vidual members of the families likely result from varia­ chemically and spectrally distinct from the major, etio­ tions in ligand specificity, restricted tissue or cell-type lated-tissue form (Abe et al. 1985; Shimazaki and Pratt localization, or different pathways of cellular activation. 1985; Tokuhisa et al. 1985). It is possible that phyB for By analogy, the family of homologous but markedly di­ phyC corresponds to this low abundance phytochrome vergent phytochrome polypeptides that we have de­ or, alternatively, that the partially purified chromopro­ scribed share structural features but may perform widely tein fractions from oat and pea are mixtures of the ho­ different roles in the regulation of higher plant photo- mologs of phyA, phyB, and phyC in these plant species. morphogenesis. These questions can now be approached using antisera specific to the A, B, and C forms of phytochrome. Analysis of the previously published sequences of phytochrome from oat, rice, corn, zucchini, and pea in­ Phytochrome has been detected spectrally in all an- dicates that these proteins are all homologs of the A. giosperm and gymnosperm plants that have been exam­ thaliana phyA gene product. The relatively abundant ined, in ferns and bryophytes, and in some species of phyA phytochrome from dark-grown plant tissue is a algae (Correll et al. 1977). Currently, sequence informa­ chromoprotein that exists in two spectrally distinct tion is available only for phytochrome from a few angio- confirmations, Pj and Pf^, and photoconversion between sperm genera. Comparison of these sequences shows these two conformations underlies the role of phy­ that the origins of the phyA, phyB, and phyC genes were tochrome as a regulatory molecule. The phyB and phyC very likely gene duplications that occurred early in higher plant evolution, long before the divergence of the gene products contain regions of high sequence simi­ two major groups of angiosperms, the monocots and larity to phyA phytochrome, notably at and around the dicots. This expansion and divergence of the phy- chromophore attachment site, and the calculated hydro­ tochrome-coding capacity may have accompanied emer­ pathic properties of the three proteins are very similar. gence of novel mechanisms of regulation of photomor- Though this strongly suggests that phyB and phyC are phogenesis in early plants. The ancient origins of the indeed apoproteins for red/far red light-responsive pho­ phytochrome gene family also indicate the. phyA, phyB, toreceptors, rigorous proof of this awaits spectral charac- GENES & DEVELOPMENT 1753 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Sharrock and Quail and phyC homologs are likely to be present in all angio- phyA, the phyB and phyC mRNAs are present at low sperms and, perhaps, all higher plants. Though pub­ levels and are not significantly light-regulated. The pre­ lished data have been interpreted as indicating the pres­ dominance of phyA mRNA in dark-grown tissue indi­ ence of only a single phytochrome gene in pea (Sato cates that the phyA receptor is likely to be the most 1988) and in rice (Kay et al. 1989b), these studies were abundant phytochrome in etiolated seedlings and may performed using hybridization conditions that would play a specific role in the de-etiolation process. In fully not favor detection of distantly related sequences. Pre­ green plant tissue, the levels of the mRNAs for the three viously, we presented evidence for multiple phy- photoreceptors are within severalfold of each other, tochrome-related sequences in DNA blots of tomato making it less likely that one phytochrome is physically (Sharrock et al. 1988). If the A, B, and C forms of phy­ or functionally predominant. tochrome are conserved elements of higher plant pho- Though the phyA gene is the only member of the Ara­ toregulation systems, the roles of these receptors in the bidopsis phytochrome family that has been shown to be regulation of photomorphogenesis in A. thaliana may regulated at the level of mRNA abundance, all three phy also be conserved across a wide range of plant genera. mRNAs contain URFs in their 5'-leader regions, pre­ Amino acid identity profiles of the phyA, phyB, and ceding the initiator AUG for the phytochrome-coding phyC sequences aligned in the three possible pairwise sequence. These URFs contain 3-12 in-frame codons combinations indicate that similar regions of the three before a translation termination codon is reached. Most polypeptides have been conserved and that no deletion, eukaryotic mRNAs do not contain URFs (Kozak 1987), replacement, or rearrangement of large structural do­ and, in some cases, mRNAs that contain URFs show mains has occurred. Notable deviations from this con­ complex translational regulation. For example, Mueller served structure are the 3 5-residue amino-terminal and and Hinnebush (1986) demonstrated that the four 5'- 11-residue carboxy-terminal extensions of the phyB leader URFs in the yeast GCN4 mRNA have strong reg­ polypeptide. As was observed in comparison of phyA se­ ulatory effects on translation of the downstream coding quences from monocot and dicot plant species (Sharrock sequences. All dicot phytochrome 5' leaders that have et al. 1986), the largest blocks of amino acid sequence been sequenced, including phyA from zucchini (Shar­ conserved among phyA, phyB, and phyC (Figs. 2B and 3) rock et al. 1986), pea (Sato 1988), and Arabidopsis and are at and around the cysteine residue (position 361 in phyB and phyC, contain at least one URF. Moreover, the Fig. 2B), which serves as the chromophore attachment multiple phyA mRNA 5' ends encoded by the complex site (Lagarias and Rapoport 1980). Native phyA phy­ phyA promoters of pea (Sato 1988) and Arabidopsis (R. tochrome is purified from the soluble fraction of plant Sharrock and P. Quail, unpubl.) contain differing extracts (Vierstra and Quail 1983) and appears, by immu- numbers of URFs, from one URF in the shortest 5'-un­ nocytochemistry, to be distributed evenly in the cyto­ translated sequence to four URFs in the longest. Mon­ plasm of etiolated-tissue cells (McCurdy and Pratt 1986; ocot phytochrome 5' leaders, including phyA from oat Saunders et al. 1983). From consideration of the hydro­ (Hershey et al. 1985), rice (Kay et al. 1989a), and com pathic properties of the proteins (Fig. 4), Arabidopsis (Christensen and Quail 1989), do not contain URFs. phyB and phyC also appear to be soluble proteins, and Hence, it is possible that regulation of dicot phy­ although phytochrome modulation of membrane proper­ tochrome gene expression, including all members of the ties and physical association of phytochrome with gene family, includes a component of translational regu­ membranes or plastids have been reported (for review, lation that is not present in monocots. see Roux 1986), no membrane-spaiming or transit pep­ The biology of receptor systems in plants is poorly un­ tide sequences are predicted within the phyB and phyC derstood as compared to such systems in animals. The proteins. mechanisms through which physical and chemical In addition to encoding divergent polypeptides, the A. signals are perceived and transmitted in plants may be thahana phyA, phyB, and phyC genes are expressed in related to mechanisms that operate in animal receptor different ways, quantitatively and qualitatively. Tran­ systems or they may be unique. In the case of the phy­ scripts for all three phytochromes are detected in RNA tochrome system, absorption of a photon of light by a from 5-day-old seedlings and are represented in a cDNA soluble chromoprotein receptor triggers a diverse and library made from RNA from 3-week-old rosette leaves. complex array of growth and developmental responses. The phyA mRNA is the most abundant of the three in The discovery of multiple phytochrome genes in A. tha­ dark-grown (etiolated) tissue and is down-regulated in hana suggests that, as in many animal receptor systems, the presence of white light. Light-induced down-regula­ diversity of response in plant light perception may re­ tion of phyA mRNA abundance has been described in flect heterogeneity of receptor structure and differential several plant species. In monocots, this effect is rapid patterns of expression of a family of receptor genes. With and pronounced, is mediated by the phytochrome the identification and characterization of the phyA, system itself (Colbert et al. 1985), and is, in large part, phyB, and phyC phytochromes, we are now in a position due to reduced transcription of phyA genes (Lissemore to develop peptide-specific antisera, determine the and Quail 1988). In dicots, down-regulation of phyA tissue localization of the various phytochromes, and mRNA is less pronounced (Lissemore et al. 1987; Sato begin analysis of the functions of these gene products 1988) and, in the case of Arabidopsis, appears to require using classical and molecular genetic approaches in Ara­ the presence of continuous white light. In contrast to bidopsis. GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochromes in Arabidopsis Materials and methods Library screening An amplified XgtlO library of size-fractionated (3- to 6-kb frac­ Plant material and growth conditions tion) A. thaliana cDNAs was supplied by N. Crawford (Univer­ All experiments were performed using A. thaliana land race sity of California, San Diego). The cDNA was prepared from Columbia. Seeds were purchased from Guhy's Nursery poly(A)+ RNA isolated from rosette leaves of plants grown (Tucson, Arizona). Plants used for preparation of DNA were 16-20 days under continuous illumination (Crawford et al. grown for 3 weeks in soil at 24°C under fluorescent light. For 1988). Approximately 250,000 recombinant phage were plated, preparation of RNA, -5000 seeds were sterihzed for 60 min in and the plaques were transferred to nitrocellulose using stan­ 20% bleach/0.2% SDS and washed six times in sterile water. dard methods (Maniatis et al. 1982). Filters were prehybridized Sterile seeds were distributed onto a Whatman No. 1 filter and hybridized with the 0.9-kb coding-region probe in 30% paper disk overlaying 0.8% agar/0.5 x Murashige-Skoog salts formamide buffers and were washed at low stringency, as de­ (Difco) in a 150 X 25-mm petri dish and placed at 4°C in com­ scribed above for DNA blots. Prospective phytochrome-related plete darkness. After 7 days, the seeds were brought to room clones were plaque-purified, and phage DNA was prepared for temperature and irradiated for 10 min with white light. The subcloning (Grossberger 1987). plates were sealed, wrapped in foil, and incubated for 5 days at 24°C in the dark. Under these conditions, seed germination was >90% and etiolated seedlings were ~1 cm tall. Irradiation of RNA preparation and analysis 5-day-old seedings was performed at 24°C for periods of 5 min with red or far red light (Lissemore et al. 1987). Seedlings were All RNA preparation procedures were carried out on ice, using harvested 3 hr after irradiation and frozen in liquid N^. White baked glassware and solutions treated with diethylpyrocar- light irradiation was performed under fluorescent bulbs at 24°C bonate. Phenol/isoamyl alcohol/chloroform 25 : 1 : 25 (PIC) for the indicated times. The outputs of the red, far red, and was equilibrated four times with 100 mM Tris-HCl (pH 8.3) and white light sources were 8 W/m^, 11 W/m^, and 28 W/m^, re­ 10 mM EDTA. RNA was prepared from 1-3 grams fresh weight spectively, as measured by an EG&G Gamma Scientific model whole plant A. thaliana tissue. Frozen tissue was ground to a 550-1 radiometer/photometer. powder in liquid Nj in a mortar and pestle, transferred to a 30-ml Corex tube containing 5 ml of extraction buffer [50 mM Tris-HCl (pH 8.3), 150 mM NaCl, 10 mM EDTA, 1% lauryl sar- cosine], and mixed with a Polytron at low speed. An equal volume of PIC was then added, and the sample was mixed with Plant DNA preparation and analysis the Polytron at high speed for 1 min. After centrifugation, the Total A. thaliana DNA was prepared by the method of Au- aqueous phase was extracted three more times with PIC, and subel et al. (1989). Samples containing 3 |xg of DNA were di­ the nucleic acids precipitated with Na acetate/ethanol. The gested with restriction enzymes, separated on 0.8% agarose precipitates were dissolved in 10 mM Tris-HCl (pH 8.3) and 10 gels, and transferred to GeneScreen Plus (Dupont) hybridization mM EDTA, and RNA was precipitated twice with 2 M LiCl, the membranes according to procedures recommended by the man­ first time overnight on ice in a total volume of 4 ml and the ufacturer. Blots probed with the 0.9-kb coding-region probe (Fig. second time for 5-6 hr in a volume of 2 ml. The RNA pellet 1) were prehybridized for 12 hr at 42°C in 30% formamide, 5 x was dissolved in 0.27 ml HjO and ethanol-precipitated. RNA SSC, 5 X Denhardt's solution, 40 mM NaP04 (pH 6.8), 0.5% yields were 80-100 |xg of RNA per gram of tissue for etiolated BSA, 1% SDS, and 100 M-g/ml sonicated denatured salmon seedlings and 150-300 |xg of RNA per gram of tissue for green testes DNA and subsequently hybridized to the probe for 18 hr seedlings. at 42°C in 30% formamide, 5x SSC, 40 mM NaP04 (pH 6.8), Samples of total RNA (5 jjig) were separated by electropho­ 10% dextran sulfate (M, = 500,000), and 100 jjig/ml soni­ resis in 0.8% agarose/3% formaldehyde gels containing 20 mM cated denatured salmon testes DNA. These membranes were NaP04 (pH 6.8) and transferred to GeneScreen hybridization washed under low-stringency conditions: twice for 20 min at membranes (Dupont), using procedures recommended by the room temperature and once for 1 hr at 60°C in 2 x wash solu­ manufacturer. Membranes were prehybridized and hybridized tion (2x SSC, 5 mM EDTA, 1.5 mM sodium pyrophosphate, to the gene-specific ssDNA probes A, B, and C (Fig. 1) in 50% 0.5% SDS). Blots hybridized with transcript-specific probes formamide buffers and were washed at high stringency as de­ (probes A, B, C, Fig. 1) were treated in the same way, except the scribed above for DNA blots. prehybridization and hybridization buffers contained 50% formamide and the final wash was for 1 hr at 65°C in 0.1 x wash solution (high-stringency conditions). Autoradiography DNA sequencing and sequence analysis was done at - 70°C with an intensifying screen. The coding-region hybridization probe (0.9-kb probe; Fig. 1) The cDNA inserts from clones XA2-3, \A1-1, and X.A7-5 were was a ^^P-labeled, ssDNA synthesized from a recombinant subcloned into M13mpl8 and sequenced completely in both di­ M13mpl8 (Yanisch-Perron et al. 1985) phage containing a 925- rections by the dideoxy method (Sanger et al. 1977), using syn­ bp Pstl fragment of A. thaliana phytochrome-coding sequence. thetic oligonucleotides as primers. DNA and polypeptide se­ Preparation of this probe has been described (Sharrock et al. quence analysis and alignment were performed using the pro­ 1988). Transcript-specific ssDNA probes were prepared using as grams of the UWGCG Software Package (Devereux et al. 1984). template sense-strand ssDNA of M13mpl8 clones of the most Gaps in the aligned polypeptide sequences (Fig. 2B) were intro­ 3 ' £coRI fragments of the phyA, phyB, and phyC cDNA inserts duced according to the BESTFIT program and by eye and are (Fig. 1). Synthetic oligonucleotides, annealed to these templates parsimonious in that the number of gaps introduced to opti­ just upstream of the poly(A) tails (Fig. 2A), were extended with mize sequence similarity have been kept to a minimum. Gaps Klenow fragment in the presence of [^^pjdCTP, truncated with in the nucleotide sequence (Fig. 2A) were introduced at posi­ PstliphyA), Rsal(phyB], or PflMl{phyC), and the labeled single- tions corresponding to the gaps in the peptide sequences. stranded DNAs were purified from denaturing gels as described Alignment of the eight available phytochrome polypeptide se­ (Sharrock et al. 1988). quences (Table 1) was done using the BESTFIT and LINEUP GENES & DEVELOPMENT 1755 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Shatiock and Quail programs and by eye. Parsimony analysis of 325 phylogenetic- gene products expressed in etiolated Avena. Nucleic Acids ally informative sites in the phytochrome nucleic acid se­ Res. 13: 8543-8559. quences was performed using the programs of Felsenstein Hillman, W.S. 1967. The physiology of phytochrome. Annu. (1985). Rev. Plant Physiol. 18: 301-324. Jabben, M. and M.G. Holmes. 1983. Phytochrome in light- grown plants. In Photomorphogenesis. Encyclopedia of plant physiology, new series, vol. 16B (ed. W. Shropshire and H. Acknowledgments Mohr), pp. 704-722. Springer-Verlag, Berlin. We thank Dr. Nigel Crawford for his gift of the A. thaliana Jones, A.M. and P.H. Quail. 1986. Quaternary structure of 124- cDNA library, Jo Anne Welsch for excellent technical assis­ kilodalton phytochrome from Avena sativa L. Biochemistry tance, Susan DeSimoni and Dr. Christiana Gatz for their con­ 25: 2987-2995. tributions to the early phase of this work, and Drs. Sheila Kaufman, L.S., W.F. Thompson, and W.R. Briggs. 1984. Dif­ McCormick, Alan Christensen, and Tim Caspar for critical ferent red light requirements for phytochrome-induced ac­ reading of the manuscript. This work was supported by Depart­ climation of cab RNA and rbcs RNA. Science 226: 1447- ment of Energy grant DE-FG03-87ER13742 and U.S. Depart­ ment of Agriculture grant 85-CRCR-1-1578 to P.H.Q. R.A.S. Kay, S.A., B. Keith, K. Shinozaki, and N.-H. Chua. 1989a. The was the recipient of postdoctoral fellowship DMB-8508836 sequence of the rice phytochrome gene. Nucleic Acids Res. from the National Science Foundation. 17: 2865-2866. Kay, S.A., B. Keith, K. Shinozaki, M.-L. Chye, and N.-H. Chua. 1989b. The rice phytochrome gene: Structure, autoregulated expression, and binding of GT-1 to a conserved site in the 5' References upstream region. Plant Cell 1: 351-360. Abe, R , K.T. Yamamoto, A. Nagatani, and M. Furuya. 1985. Kozak, M. 1987. An analysis of 5'-noncoding sequences from Characterization of green tissue-specific phytochrome iso­ 699 vertebrate messenger RNAs. Nucleic Acids Res. lated immunochemically from pea seedlings. Plant Cell 20: 8125-8148. Physiol. 26: 1387-1399. Kronenberg, G.H.M. and R.E. Kendrick. 1986. The physiology Ausubel, F.M., R. Brent, R.E. Kingston, D.D. Moore, J.G. of action. In Photomorphogenesis in plants (ed. R.E. Ken­ Seidman, J.A. Smith, and K. Struhl, eds. 1989. Cunent pro­ drick and G.H.M. Kronenberg), pp. 99-114. Martinus Nij- tocols in molecular biology, pp. 2.3.1-2.3.3. Greene Pub­ hoff Publishers, Dordrecht. lishing Associates and Wiley-Interscience, New York. Kyte, J. and R.F. Doolittle. 1982. A simple method for dis­ Butler, A., A. Wei, K. Baker, and L. Salkoff. 1989. A family of playing the hydropathic character of a protein. /. Mol. Biol. putative potassium channel genes in Drosophila. Science 157: 105-132. 243: 943-947. Lagarias, J.C. and H. Rapoport. 1980. Chromopeptides from Christensen, A.H. and P.H. Quail. 1989. Structure and expres­ phytochrome. The structure and linkage of the P, form of sion of a maize phytochrome-encoding gene. Gene (in press). the phytochrome chromophore. /. Am. Chem. Soc. 102:4821-4828. Colbert, J.T., H.P. Hershey, and P.H. Quail. 1985. Phytochrome regulation of phytochrome mRNA abundance. Plant Mol. Lidgard, S. and P.R. Crane. 1988. Quantitative analysis of the early angiosperm radiation. Nature 331: 344-346. Biol. 5: 1-101. Correll, D.L., J.L. Edwards, and W. Shropshire, eds. 1977. Phy­ Lissemore, J.L. and P.H. Quail. 1988. Rapid transcriptional reg­ tochrome: A bibhography with author, biological mate­ ulation by phytochrome of the genes for phytochome and rials, taxonomic, and subject indexes of publications prior chlorophyll a/b binding protein in Avena sativa. Mol. Cell. Biol. 8: 4840-4850. to 1975. Smithsonian Institution Press, Washington, D.C. Crawford, N.M., M. Smith, D. BeUissimo, and R.W. Davis. Lissemore, J.L., J.T. Colbert, and P.H. Quail. 1987. Cloning of 1988. Sequence and nitrate regulation of the Arabidopsis cDNA for phytochrome from etiolated Cucurbita and coor­ thaliana mRNA encoding nitrate reductase, a metalloflavo- dinate photoregulation of the abundance of two distinct phytochrome transcripts. Plant Mol. Biol. 8: 485-496. protein with three fimctional domains. Proc. Natl. Acad. Sci. 85: 5006-5010. Mancinelli, A.L. and I. Rubino. 1978. The 'high irradiance' re­ Devereux, J., P. Haeberli, and O. Smithies. 1984. A comprehen­ sponses of plant photomorphogenesis. Bot. Rev. 44: 129- sive set of sequence analysis programs for the VAX. Nucleic 150. Acids Res. 12: 387-395 . Mandoli, D.F. and W.R. Briggs. 1981. Phytochrome control of Doolittle, R.F. 1981. Similar amino acid sequences: Chance or two low-irradiance responses in etiolated oat seedlings. common ancestry? Science 214: 149-159. Plant Physiol. 67: 733-739. Evans, R.M. 1988. The steroid and thyroid hormone receptor Maniatis, T., E.F. Fritsch, and J. Sambrook. 1982. Molecular superfamily. Science 240: 889-895. cloning: A laboratory manual. Cold Spring Harbor Labora­ Felsenstein, J. 1985. Confidence limits on phylogenies: An ap­ tory, Cold Spring Harbor, New York. proach using the bootstrap. Evolution 38: 783-791. Martin, W.F., A. Gierl, and H. Saedler. 1989. Molecular evi­ Feng, D.F., M.S. Johnson, and R.F. Doolittle. 1985. Aligning dence for pre-Cretaceous angiosperm origins. Nature amino acid sequences: Comparison of commonly used 339: 46-48 . methods. /. Mol. Evol. 21: 112-125. McCurdy, D.W. and L.H. Pratt. 1986. Immunogold electron mi­ croscopy of the phytochrome in Avena: Identification of in­ Giguere, V., N. Yang, P. Segui, and R.M. Evans. 1988. Identifi­ cation of a new class of steroid hormone receptors. Nature tracellular sites responsible for phytochrome sequestering 331: 91-94. and enhanced pelletability. /. Cell. Biol. 103: 2541-2550. Grossberger, D. 1987. Minipreps of DNA from bacteriophage Meyerowitz, E.M. 1987. Arabidopsis thaliana. Annu. Rev. lambda. Nucleic Acids Res. 15: 6737. Genet. 21:93-111 . Hershey, H.P., R.F. Barker, K.B. Idler, J.L. Lissemore, and P.H. Mueller, P.P. and A.G. Hirmebush. 1986. Multiple upstream Quail. 1985. Analysis of cloned cDNA and genomic se­ AUG codons mediate translational control of GCN4. Cell quences for phytochrome: Amino acid sequences for two 45: 201-207. 1756 GENES & DEVELOPMENT Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochromes in Arabidopsis Yarden, Y. and A. Ullrich. 1988. Growth factor receptor tyro­ Ohno, S., Y. Akita, Y. Konno, S. Imajoh, and K. Suzuki. 1988. A sine kinases. Armu. Rev. Biochem. 57: 443-478. novel phorbol ester receptor/protein kinase, nPKC, distantly related to the protein kinase C family. Cell 53: 731-741. Roux, S.J. 1986. Phytochrome and membranes. In Photomor- phogenesis in plants (ed. R.E. Kendrick and G.H.M. Kronen- berg), pp. 115-136. Martinus Nijhoff Publishers, Dordrecht. Rudiger, W. and H. Scheer. 1983. Chromophores in photomor- phogenesis. In Photomorphogenesis. Encyclopedia of plant physiology, new series, vol. 16A (ed. W. Shropshire and H. Mohr), pp. 119-151. Springer-Verlag, Berlin. Salisbury, F.B. and C.W. Ross. 1985. Plant physiology. Wads- worth Publishing Company, Belmont. Sanger, F., S. Nicklen, and A.R. Coulson. 1977. DNA se­ quencing with chain-terminating inhibitors. Pioc. Natl. Acad. Sci. 74: 5463-5467. Sato, N. 1988. Nucleotide sequence and expression of the phy­ tochrome gene in Pisum sativum: Differential regulation by light of multiple transcripts. Plant Mol. Biol. 11: 697-710. Saunders, M.J., M.-M. Cordonnier, B.A. Palevitz, and L.H. Pratt. 1983. Immimofluorescence visualization of phytochrome in Pisum sativimi L. epicotyls using monoclonal antibodies. Planta 159: 545-553. Schaeffer, £., D. Smith, G. Mardon, W. Quinn, and C. Zuker. 1989. Isolation and characterization of two new Drosophila protein kinase C genes, including one specifically expressed in photoreceptor cells. Cell 57: 403-412. Sharrock, R.A., J.L. Lissemore, and P.H. Quail. 1986. Nucleo­ tide and amino acid sequence of a Cucuibita phytochrome cDNA clone: Identification of conserved features by com­ parison with Avena phytochrome. Gene 47: 287-295. Sharrock, R.A., B.M. Parks, M. Koomneef, and P.H. Quail. 1988. Molecular analysis of the phytochrome deficiency in an aurea mutant of tomato. Mol. Gen. Genet. 213: 9-14. Shimazaki, Y. and L.H. Pratt. 1985. Immunochemical detection with rabbit polyclonal and mouse monoclonal antibodies of different pools of phytochrome from etiolated and green Avena shoots. Planta 164: 333-344. Shropshire W. and H. Mohr, eds. 1983. Photomorphogenesis. Encyclopedia of plant physiology, new series, vol. 16A and 16B. Springer-Verlag, Berlin. Smith, H. 1986. The perception of light quality. In Photomor­ phogenesis in plants (ed. R.E. Kendrick and G.H.M. Kronen- berg), pp. 187-217. Martinus Nijhoff Publishers, Dordrecht. Thompson, C.C., C. Weinberger, R. Lebo, and R.M. Evans. 1987. Identification of a novel thyroid hormone receptor ex­ pressed in the mammalian central nervous system. Science 237: 1610-1614. Tokuhisa, J.G. and P.H. Quail. 1983. Spectral and immuno­ chemical characterization of phytochrome isolated from light-grown Avena sativa. (abstr.) Plant Physiol. Suppl. 72: 85. Tokuhisa, J.G., S.M. Daniels, and P.H. Quail. 1985. Phy­ tochrome in green tissue: Spectral and immunochemical ev­ idence for two distinct molecular species of phytochrome in light-grown Avenfl sativa L. Planta 164: 321-332 . Vierstra, R.D. and P.H. Quail. 1983. Purification and initial characterization of 124-kilodalton phytochrome from Avena. Biochemistry 22: 2498-2504. . 1986. The protein. In Photomorphogenesis in plants (ed. R.E. Kendrick and G.H.M. Kronenberg), pp. 35-60. Mar­ tinus Nijhoff Publishers, Dordrecht. Yanisch-Perron, C., J. Viera, and ]. Messing. 1985. Improved M13 phage cloning vectors and host strains: Nucleotide se­ quences of the M13mpl8 and pUC19 vectors. Gene 22:103 - GENES & DEVELOPMENT 1757 Downloaded from genesdev.cshlp.org on December 7, 2021 - Published by Cold Spring Harbor Laboratory Press Novel phytochrome sequences in Arabidopsis thaliana: structure, evolution, and differential expression of a plant regulatory photoreceptor family. R A Sharrock and P H Quail Genes Dev. 1989, 3: Access the most recent version at doi:10.1101/gad.3.11.1745 This article cites 43 articles, 11 of which can be accessed free at: References http://genesdev.cshlp.org/content/3/11/1745.full.html#ref-list-1 License Receive free email alerts when new articles cite this article - sign up in the box at the top Email Alerting right corner of the article or click here. Service Copyright © Cold Spring Harbor Laboratory Press

Journal

Genes & DevelopmentUnpaywall

Published: Nov 1, 1989

There are no references for this article.